Riksdagens snabbprotokoll

2017/18:133

 

 

Fredagen den 15 juni

 

Kl.  09.00–12.49

 

Det justerade protokollet beräknas utkomma om tre veckor.

 


§ 1  Justering av protokoll

 

Protokollet för den 25 maj justerades.

§ 2  Anmälan om återtagande av plats i riksdagen

 

Talmannen meddelade att Hannah Bergstedt (S) återtagit sin plats i riksdagen från och med den 15 juni, varigenom uppdraget som ersättare upphört för Linus Sköld (S).

§ 3  Ärenden för hänvisning till utskott

 

Följande dokument hänvisades till utskott:

Proposition

2017/18:268 till civilutskottet

 

Kammaren biföll talmannens förslag att behandlingen av ovanstående proposition skulle få uppskjutas till nästa valperiod.

 

Motioner

2017/18:4198–4201 till kulturutskottet

§ 4  Ärenden för bordläggning

 

Följande dokument anmäldes och bordlades:

Konstitutionsutskottets betänkanden och utlåtande

2017/18:KU20 Granskningsbetänkande

2017/18:KU46 Ett enhetligt regionalt utvecklingsansvar

2017/18:KU40 Indelning i utgiftsområden och en sammanhållen budgetprocess

2017/18:KU47 Uppskov med behandlingen av vissa ärenden

2017/18:KU48 Subsidiaritetsprövning av kommissionens förslag till direktiv om skydd för personer som rapporterar om överträdelser av unionsrätten

 

Utrikesutskottets betänkande

2017/18:UU10 Verksamheten i Europeiska unionen under 2017

 

Civilutskottets utlåtande och betänkanden

2017/18:CU33 Subsidiaritetsprövning av kommissionens förslag till direktiv om grupptalan och om revidering av fyra konsumenträttsdirektiv

2017/18:CU35 Riksrevisionens rapport om tillsynen av ställföreträdare och överförmyndare

2017/18:CU39 Strategi för Levande städer – Politik för en hållbar stadsutveckling

 

Finansutskottets betänkanden

2017/18:FiU45 En ny lag om försäkringsdistribution

2017/18:FiU50 Uppskov med behandlingen av vissa ärenden

§ 5  Energipolitikens inriktning

 

Näringsutskottets betänkande 2017/18:NU22

Energipolitikens inriktning (prop. 2017/18:228)

föredrogs.

Anf.  1  SOFIA FÖLSTER (M):

Herr talman! Utan trygg energiförsörjning stannar vårt samhälle och vår ekonomi. Det är lätt att glömma en fredag i juni när solen skiner och det har varit värmerekord i snart två månader, men så ser det inte ut varje dag i Sverige. Det finns de dagar när det är mörkt när vi går till jobbet och det är mörkt när vi går hem. Men även de dagarna förväntar vi oss att lamporna tänds både hemmavid och i operationssalar, vi förväntar oss att våra hus är uppvärmda och att industrin får den energi den behöver för att hjulen ska snurra i svensk ekonomi.

Det är väl just människors förväntan om att försörjningstryggheten alltid ordnar sig som gör att energifrågan inte dominerar Agendas partiledardebatter just nu. Människor förväntar sig att det alltid finns tillräckligt med el i näten liksom de förväntar sig att elmarknaden utformas på ett sådant sätt att den gynnar vår konkurrenskraft och tillväxt. De förväntar sig att även på energiområdet, liksom i samhället i övrigt, gör politikerna sitt absolut yttersta för att minska klimatutsläppen.

Det är denna förväntan om att politiken klarar att lägga ett starkt fundament för bottenplattan i svensk ekonomi och industri som har lett fram till den energiöverenskommelse med den inriktning och de mål som vi delvis tar ställning till i dag. Det handlar om att just konkurrenskraft, försörjningstrygghet och ekologisk hållbarhet visar vägen framåt.

Detta har krävt pragmatism från alla partier som har varit med i överenskommelsen, dock en pragmatism som jag tror har varit förväntad och efterlängtad i debatten. I stället för att stånga sig blodig för eller emot ett enskilt kraftslag finns nu mål och långsiktiga villkor på plats som kan hålla över tid. Med det överordnade målet om noll nettoutsläpp fram till 2045 har vi faktiskt lyckats enas om 100 procent förnybar energiproduktion till 2040. Samtidigt gör vi också ett tydligt ställningstagande om att det inte är ett stoppdatum för kärnkraften. Det innebär att politiker inte längre kan ta sig rätten att stänga lönsamma kärnkraftverk i förtid. Dessutom är skatten på kärnkraft och fastighetsskatten för vattenkraft sänkt för att utjämna konkurrensvillkoren mellan kraftslagen.

Herr talman! Det är just den typen av pragmatism som är helt nödvändig på resan mot teknikneutrala spelregler på energiområdet. Vi kramar inte om ett särskilt kraftslag, en särskild teknik eller för den delen ett särskilt företag, där ideologiska skygglappar inte gör att vi slår in på samma väg som till exempel Tyskland, som stänger och ersätter utsläppsfria kärnkraftverk med kol och gas. Vi prioriterar visserligen energisystemets omställning, men vi gör det på ett sätt så att det sker under marknadsmässiga förutsättningar.

Jag började med att tala om förväntningar och människors förväntningar på politiken. Höga förväntningar på politiken är naturligtvis rätt och riktigt. Men samtidigt vet vi också att de största framstegen förutsätter ett konkurrenskraftigt näringsliv, och det förutsätter att hinder undanröjs för företag som utvecklar framtidens energiteknik så att de har möjlighet att snabbt växa och snabbt exportera sina produkter. Om vi ska vara helt ärliga med oss själva är det inte i den här kammaren som de största klimatkliven tas.

Se till exempel på företaget som uppfann LED-lampan, som helt revolutionerade tekniken för hur vi använder energi. Den uppfanns inte här i kammaren. Eller se på katalysatorn. Den är inte heller en produkt av politiska beslut. Den har minskat de miljöfarliga utsläppen från bilar med 80–95 procent.

Nu är frågan: Kommer nästa startup som revolutionerar energianvändandet så att vi når vårt gemensamma mål om 50 procent effektivare energianvändning till 2030 att startas här i kammaren? När kommer nästa kliv inom energilagring? Vilket företag kommer att vinna det race som nu pågår om elbilen, som därmed kommer att snabbspola hela elektrifieringen av transportsektorn?

För oss blir frågan: Kommer de startup-företagen att starta i Sverige? Om de startar i Sverige, kommer de att kunna växa i Sverige och exportera sina produkter från Sverige? Här behövs en rad reformer om det ska vara möjligt. Det behövs ordentliga regelförenklingar för företagare, inte minst för dem som gör produkter och utövar tjänster inom energieffektivisering, energilagring och försäljning av småskalig produktion av el. De företagsskatter som regeringen har höjt behöver åter sänkas, och det får inte råda något tvivel om var Sverige står i viktiga frihandelsfrågor om miljöteknik ska kunna exporteras till de länder som behöver det mest.

Låt mig också kort avsluta med att nämna några av de reservationer som Moderaterna har i betänkandet. Två av reservationerna rör biobränsle, där spelreglerna tyvärr varit motsatsen till långsiktiga och marknadsmässiga. Biobränsle är helt avgörande för att vi ska kunna ställa om i transportsektorn och är en viktig byggsten i värme- och kraftproduktionen. Här måste regeringen göra mer, inte minst för att stoppa dem som vill förbjuda vissa typer av biodrivmedel på EU-nivå. Om vi ska kunna ställa om transportsektorn behövs alla typer av biodrivmedel. Vi kan inte göra den omställningen över en natt.

En av våra reservationer rör fjärr- och kraftvärme, där förutsättningarna på marknaden behöver förbättras. Och ytterligare en av våra reservationer, som vi har talat om i kammaren många gånger förut, rör anslagen till forskning. Vi menar att det måste gå att forska på alla Sveriges stora kraftslag, och det inkluderar naturligtvis kärnkraften. Oavsett regeringsfärg kommer kärnkraften att vara en betydande del av den svenska energimixen under överskådlig tid framöver. Givet det borde Sverige naturligtvis vara i framkant vad gäller effektivitet, drift och avfallshantering. Därför anser vi naturligtvis att forskningsanslagen från Energimyndigheten också måste gå till att forska på kärnkraft.

För tids vinnande yrkar jag bifall endast till reservation 19.

(Applåder)

Anf.  2  MATTIAS BÄCKSTRÖM JOHANSSON (SD):

Herr talman! Det här blir den sista energipolitiska debatten i kammaren för mandatperioden. Jag skulle initialt vilja passa på att tacka för de debatter som har varit under mandatperioden och det arbete som har skett under den gångna mandatperioden, även om vi långt ifrån är överens i alla delar.

Det har under mandatperioden hänt en del i energifrågorna. Vissa saker är glädjande, ska tillstås, främst den kraftiga sänkningen av fastighetsskatten för vattenkraften och borttagandet av straffskatten för kärnkraften. Det har skapat mer långsiktiga villkor för reglerkraften i Sverige. Förhoppningsvis går vi nu också mot förenklingar för den småskaliga vattenkraften, vilket är viktigt även i de södra delarna av Sverige.

Samtidigt är de kompromisser som finns i energiöverenskommelsen destruktiva ur vårt perspektiv sett. Viljan att få till en överenskommelse har lett till att motsättningar byggts in i överenskommelsen, vilket äventyrar den övergripande målbilden för energipolitiken. Det är fortfarande så att även om företrädare för andra partier talar här i kammaren om en förståelse för skillnaden mellan energi och effekt saknas varje tillstymmelse till handling som visar på någon form av förståelse utifrån det som nu sker.

Kraftbalansen för en tioårsvinter är redan nere på negativa värden. Sett till en normalvinter är den nere på negativa värden om ett par år. Svängmassan i vårt kraftsystem blir allt mindre eftersom större synkrongeneratorer fasas ut, vilket bidrar till att vi i en snar framtid kommer att ha ett extremt känsligt kraftsystem inom vårt synkrona område. Men det ligger i linje med det som präglat mycket av debatterna, där melodin för energipolitiken främst har varit kvantitet medelst bidragssubventioner i stället för kvalitet.

Herr talman! För Sverigedemokraterna är det uppenbart att vi är i behov av planerbar kraftproduktion även i framtiden. Det är en sund balans mellan reglerkraft och annan planerbar kraftproduktion som möjliggör integration av tämligen stora mängder väderberoende kraftproduktion. Det är även detta som historiskt sett har gjort att det svenska kraftsystemet präglats av en exceptionellt hög grad av leveranssäkerhet och elkvalitet, något som har tjänat vårt land väldigt väl. Det är därför angeläget att målen inom energipolitiken strävar mot att upprätthålla och vårda detta över tid. Det är därför beklagligt att man varken från regeringens eller större delen av Alliansens sida känner eller uttrycker oro över den utveckling vi nu ser.

I kraftbalansrapporten från Svenska kraftnät finns en bedömning av vad man ser på längre sikt. Inför den vinter som nu har passerat skrev man: ”Analysen visar att nedläggning av kärnkraften leder till ett stort antal timmar med mycket höga elpriser, samt ett flertal timmar med svårigheter att överhuvudtaget få effektbalansen att gå ihop.”

Man bör stanna upp och reflektera kring detta. Ett stort antal timmar med mycket höga elpriser – det är knappast det som kännetecknat situationen i Sverige eller som gett den svenska industrin en komparativ konkurrensfördel att verka i Sverige mot de marknader man konkurrerar med. Men det är den situation som vi nu i allt snabbare takt går mot.

Vad gäller ”svårigheter att överhuvudtaget få effektbalansen att gå ihop” är det kanske mer tekniskt. Begreppet effektbalans kan kännas odramatiskt. Men får man inte ihop effektbalansen i ett givet ögonblick betyder det på ren svenska strömavbrott, då Svenska kraftnät kommer att koppla bort elanvändare för att få effektbalansen att gå ihop.

Därför, herr talman, är det för Sverigedemokraterna högst irrationellt att sätta upp ett mål om 100 procent förnybart. Det saknar koppling till de grundpelare som den svenska energipolitiken ska vila på. Det behöver inte leda till vare sig ökad försörjningstrygghet eller exempelvis mindre utsläpp av växthusgaser. Med stor sannolikhet kommer det i stället att leda till det rakt motsatta.

Sverigedemokraternas förslag är i stället ett mål om fossilfri elproduktion. Det ger också kärnkraften en tydligare och mer given roll det framtida energisystemet. Det ligger även ligger i linje med miljöarbetet i övrigt, som har fokus på fossilfrihet.

I detta betänkande hanterar vi också ett mål om energieffektivisering. Det är ett mål som anger att Sverige till 2030 ska ha 50 procent effektivare energianvändning jämfört med 2005, uttryckt i termer av tillförd energi i relation till bruttonationalprodukten.

Ur ett resurs och konkurrensperspektiv är det en självklarhet att använda resurserna på ett så effektivt sätt som möjligt, då den som ligger i framkant kommer att ha en konkurrensfördel.

Sverigedemokraterna är positiva till att Sverige ska ha ett mål som utgår från energiintensitet och ger drivkraft utifrån att stärka industrins konkurrenskraft genom att man använder mindre energi per producerad enhet, vilket hittills har varit en framgångssaga för industrin. Det är även bra att målet är konstruerat så att vi kan använda mer energi i framtiden avhängigt den ekonomiska utvecklingen, då det är ett mått på vårt välstånd. Där emotser Sverigedemokraterna en fortsatt positiv ekonomisk tillväxt.

Det som däremot är dåligt med målet är att det har fokus på tillförd energi och inte använd energi. Det som gör det problematiskt är den styrning som det kan leda till, som bygger på hur vi för statistik om vår energitillförsel. Det kan man tala mycket om, men utan att gå in på alltför djupa detaljer kring detta kan jag säga att det mål som främst regeringen samt Moderaterna, Centerpartiet och Kristdemokraterna vill införa innebär att de anser att man energieffektiviserar genom att stänga kärnkraftverk. Det skulle vara den största insatsen för energieffektivisering – att stänga av kärnkraft. Att stänga kraftvärmeverk skulle också vara energieffektivisering med det mål man nu har satt upp, liksom att ersätta fjärrvärme med värmepumpar. Det kanske inte direkt är intentionen, men det motiveras av det mål man nu satt upp i och med att det fokuserar på tillförd energi.

Vi anser som sagt att ett energieffektiviseringsmål är bra, liksom att det utgörs av ett energiintensitetsmål. Men då ska det i stället basera sig på använd energi för att minimera de effekter som inte är önskvärda, vilket Sverigedemokraterna även föreslår i betänkandet.

Avslutningsvis, herr talman: Sverigedemokraterna vill även införa ett mål om leveranssäkerheten som inramar det jag initialt talade om.

Problemet med den förda energipolitiken är att den helt saknar styrning mot leveranssäkerhet eller att effekt ska tillföras då behovet är som störst. Utöver att energipolitiken saknar ett mål för leveranssäkerheten är ingen enskild myndighet ansvarig för densamma. I stället är ansvaret för leveranssäkerheten uppdelat på ett flertal olika roller och aktörer. Det här skapar oklarheter och risk för ineffektivitet, vilket vi betraktar som ytterst svag politik för energiområdet i framtiden.

För att även i framtiden säkerställa att alla har tillgång till el under årets alla timmar och att kraftsystemet kännetecknas av såväl hög elkvalitet som god driftssäkerhet föreslår Sverigedemokraterna att Sverige sätter upp ett mätbart mål för leveranssäkerheten, vilket den framtida energipolitiken ska sträva efter att uppnå för att säkerställa att kommande generationer ska kunna åtnjuta samma goda tillgång på elkraft som vi har åtnjutit.

Med detta, herr talman, yrkar jag bifall till reservation 1 i betänkandet. Vi står givetvis bakom samtliga av våra reservationer, men för tids vinnande nöjer jag mig med att yrka på denna.

Anf.  3  RICKARD NORDIN (C):

Herr talman! Katastrof! Skenande elpriser! Svart i näten! Nej, de rubrikerna har vi faktiskt inte. Vi i Sverige har snarare fantastiska möjligheter att klara oss på den förnybara energin.

Vi ser att tack vare energiöverenskommelsen har vi nu ett mål om att gå just den vägen. Det målet drev också Centerpartiet i förhandlingarna om att vi ska ha 100 procent förnybart 2040. Samtidigt ska vi inte med politiska beslut stänga kärnkraften, för den fasar ut sig själv på ekonomiska villkor.

Vi ser att vindkraften växer enormt. Elcertifikatssystemet, som vi höjde med 18 terawattimmar, är snart fulltecknat. Vindkraftsbranschens besked är att man därefter klarar sig på marknadsmässiga villkor. Det är en fantastiskt välkommen utveckling.

Nu ska vi se till att vindkraften till havs får samma möjligheter som den på land genom att vi slopar anslutningsavgifterna. Därmed kan vi få mer produktion i södra Sverige som ger möjlighet att ersätta kärnkraften. Vi får också en produktion som levererar fler timmar under året.

Vi ser också att solelen växer. Det är bra att regeringen har infört flera av de förslag som Centerpartiet också har drivit. Att vi tar bort kraven på bygglov och momsregistrering och gör ett flertal andra förenklingar är bra politik.

Det är också bra att riksdagen denna vecka har beslutat om nya regler för vattenkraften och miljöregler som gör att vi ska miljöanpassa vattenkraften samtidigt som vi kan bygga ut den, inte minst effektmässigt, och samtidigt som vi inte överimplementerar EU:s vattendirektiv. Det gör att vi kan få både småskalig och storskalig vattenkraft som kan bidra till energisystemet och göra att vi den dag det inte blåser och solen inte skiner fortfarande har gott om kraft i det svenska elsystemet.

Vi ska fortfarande vara en nettoleverantör av el, och det kan vi vara på två sätt. Dels ska vi vara en direkt leverantör via de kablar till utlandet som vi är överens om att vi ska fortsätta bygga ut. Det skapar trygghet och säkerhet att vi alltid har el i näten. Dels ska vi vara en elexportör på så sätt att vi ska förädla elen. Vi ska göra klimatsmart stål, inrätta datacenter och producera tjänster som är energiintensiva, för vi kan göra det med grön el som vi sedan exporterar vidare.

Biokraften, som är en av de bortglömda energikällorna i Sverige, måste få sjystare förutsättningar. Det står i energiöverenskommelsen att även fjärrvärme och kraftvärme ska ha bra förutsättningar att agera på marknaden. Detta saknas i viss mån i dag.

I exempelvis Uppsala bygger man inte turbiner för el, utan man bygger bara för fjärrvärme. Det är ett problem, för kraftvärmen levererar som mest värme och el under kalla vinterdagar, då vi behöver det som allra bäst. Därför är det också viktigt att den får sjysta spelregler.

Det är också otroligt viktigt att vi kan använda bioenergin, så att den inte blir kvar i skogen på grund av kilometerskatter som hämmar utvecklingen och som gör att det inte blir lönsamt att utvinna den. Skogforsk säger att 5–10 procent av biomassan i skogen skulle kunna komma att bli kvar där på grund av kilometerskatter. Då blir jag orolig. Då hotas den gröna omställningen, inte bara för kraftvärmen utan också för ganska många andra delar som också behöver skogens resurser för att kunna utvecklas. Inte minst gäller det de flytande biodrivmedlen, som vi ska få in i våra bilar under en övergångsperiod tills vi går över till mer el. Den nationella elektrifieringsstrategin, som vi behöver för att ställa om vägtransportsektorn, lyser fortfarande med sin frånvaro.

Morgondagens problem handlar inte så mycket om energi – att vi kan producera tillräckligt mycket el över hela året. Det gör vi nämligen i Sverige och det kommer vi att fortsätta göra. De förutsättningarna är fantastiska.

Morgondagens problem handlar snarare om effekt – att vi varje sekund året runt har el i näten. Då handlar det inte om enstaka elavbrott – i går var det elavbrott hemma i Göteborg, där jag bor, men det var ett enstaka problem – utan om att vi ska kunna producera tillräckligt mycket under årets alla timmar. Då krävs det också en ny politik. Då krävs morgondagens lösningar på morgondagens problem. Där saknar jag politik från regeringen.

Vi har en elskatt som är platt och fast, vilket gör att elpriset inte kan variera tillräckligt mycket, för elprisets andel av den totala kostnaden är ganska liten. Detta gör att affärsmodeller hämmas. Även om elpriset är noll får man fortfarande betala lika mycket i skatt. Det är helt orimligt.

Elskatten är bra för att ta in pengar till staten, såklart, men den behöver variera med elpriset, så att man får en affärsmodell som funkar och så att man får igång det där som brukar kallas användarflexibilitet: Jag som privatperson ska inte behöva gå upp och sätta på diskmaskinen kl. 23, utan man ska se till att den går igång automatiskt, och min elbil ska laddas kl. 01–04 i stället för kl. 17–21.

Vi ser att det finns problem med elskatten också när det gäller batterilager. Man kan få skatta både för att ladda batteriet och för att ladda ur det. Det är helt orimligt.

Hela ellagen skulle behöva arbetas om, för den är fokuserad på stora produktionsanläggningar som levererar kontinuerligt. Sådant är inte morgondagens system.

Konsumenter behöver få möjlighet att få ersättning när de deltar och använder sin last. De kanske hjälper till och producerar energi via sitt batteri. Vi måste också se till att de kan få ersättning när de väljer att inte delta. Målet om leveranssäkerhet blir ganska irrelevant, för som konsument med ett batteri i källaren behöver jag inte 99,9 procents leveranssäkerhet, vilket däremot SSAB behöver. Jag kanske bara behöver 90 procents leveranssäkerhet, för jag klarar ett strömavbrott i tre timmar. Men då måste jag få ersättning för det.

Vi har en regering som har gjort en hel del bra saker. Men vi har också en regering som ibland står handfallen. När regeringen tillsätter utredningar har Centerpartiet redan offensiva förslag. När regeringen inför en solskatt inför Centerpartiet grönt avdrag, som gör att man i stället för utdragna bidragssystem – man kan få vänta upp till två år på sina solcellspengar, och det är inte säkert att de alls kommer – ska få avdraget direkt på fakturan, precis som med ROT och RUT.

Vi ska inte fastna i elsektorn, för energisystemet är betydligt större än så. Jag vill lyfta fram biogasens roll. Biogasen är det perfekta exemplet på cirkulär ekonomi, där avfall blir en möjlighet. Då måste vi också ha styrmedel som fungerar för den cirkulära ekonomin. Då är det inte självklart att varje enskild del är marknadsekonomiskt lönsam, för samhällsnyttan kommer av helheten.

Den svenska biogasen är hotad. Dansk gas som kommer in i Sverige är dubbelt subventionerad, vilket gör att den konkurrerar ut den svenska biogasen.

När regeringen säger att läget är akut betyder det att det tar ett år innan man tillsätter en utredning. För mig är det helt oacceptabelt. Nu har det kommit en utredning. Nu, när det är valår, kommer det också pengar. För mig är biogasens roll betydligt viktigare och långsiktigare än att bara agera valfläsk.

Vårt engagemang – mitt och Centerpartiets – är genuint. Vi har en kretsloppspremie som har funnits länge. Vi vet att det bästa hade varit att vi tog vara både på den svenska och på den danska gasen, för Danmark exporterar både miljönytta och skattepengar till oss. Men då behöver vi utöka marknaden. Då måste det vara lättare att köpa biogasfordon. Det behöver finnas en möjlighet att ha miljöbilsparkeringar, att göra undantag från trängselskatter och att se till att biogasbilarna blir kvar i Sverige. I dag exporteras många biogasbilar efter första ägaren till bland annat Tyskland och Nederländerna. Det duger såklart inte. Man måste ha spelregler som gör att biogasbilarna blir kvar. Där står regeringen handfallen.

Slutligen: Behållningen på energi- och klimatsidan den här mandatperioden är de två stora överenskommelser som vi har gjort. Jag har själv varit med och förhandlat fram båda.

Både Miljömålsberedningen, där vi slog fast klimatmålen, och energiöverenskommelsen, som flera i den här salen har varit med och förhandlat fram, är fantastiska. Vi har nu 75 procents enighet i Sveriges riksdag om stora delar av energipolitiken. Men detta kommer såklart att behöva utvecklas.

Den stora frågan, som blivit hängande i luften men som jag gärna önskar få svar på i den här debatten, är: Kommer Socialdemokraterna och Miljöpartiet att ta samma kreativa ansvar i opposition efter valet som man har gjort i regeringsställning? Det är ju där det prövas på riktigt. Då kan man inte stå som energiminister och ta åt sig äran, utan man måste vara mer kreativ i opposition och ta ansvar för Sverige utan att på samma sätt stå i rampljuset. Den frågan önskar jag gärna svar på.

(Applåder)

Anf.  4  BIRGER LAHTI (V):

Herr talman! Kollegor och åhörare! Nu ska vi debattera NU22, som handlar om energipolitikens inriktning.

Ända sedan början av 1900-talet, när man började använda elenergi till olika ändamål i Sverige, har vi varit kreativa och uppfinningsrika i vårt land när det gäller att hitta på olika sätt att producera el.

Vi, som ett litet land som har byggt ut stora delar av våra Norrlandsälvar till just elproduktion för att tillgodose framför allt industrins behov av el, måste inse att om vi inte hade gjort detta hade vi heller inte haft den fantastiska utveckling som vi faktiskt haft för välståndet i vårt land.

Jag har fått berättat av min far, som är född 1923, hur fantastiskt det var när elen blev indragen i byn – att få lämna bort fotogenlyktorna, att kunna laga mat utan att först göra upp eld i spisen oavsett om det var sommar eller vinter och att lagra mat i en frys, när man så småningom fick råd att köpa en, såklart. Man kunde kapa ved med eldriven vedkap. Vilka oändliga lättnader det blev i vardagen! Och kan ni tänka er – att dra in el i små byar långt upp i de norrländska skogarna ansåg svenska staten som sin uppgift.

Då har vi inte talat om skogens och malmens betydelse för vårt välstånd. Men att inte kunna tänka nytt även i energifrågorna vore väl på något sätt att inte ge tillbaka för alla de uppoffringar som gjorts för oss som fått ta del av de framgångar som framför allt elenergin har gett oss.

Vi byggde ut kärnkraften när energibehovet växte i samhället, men allteftersom tekniken gått framåt när det gäller andra sätt att producera el har fler och fler länder ställt sig frågan: Varför ska vi ha kvar kärnkraften? Den är både dyrare och betydligt farligare än andra, förnybara produktionsslag och lämnar dessutom efter sig avfall som är farligt i tusentals år. Lagringsfrågan är inte heller löst.

Vi har i vårt avlånga land enormt bra förutsättningar att bygga ut det förnybara med allt från sol och vind till biprodukter från jord- och skogsbruket. Något som skulle kunna bidra betydligt mer är exempelvis den havsbaserade vindkraften, som även Centerpartiet lyfte fram – det är jag glad för.

Beklagligt enligt min mening är att försvaret inte kan se fördelarna med havsbaserad vindkraft i stället för till exempel kärnkraft. Det blir ju kontentan: Om vi kan bygga ut det förnybara mångdubbelt kan vi avveckla kärnkraften fortare. Jag tänker bara på vilken av dessa anläggningar en eventuell fiende skulle se som mest intressant att slå ut. Att försvaret inte skulle kunna ha en övningsverksamhet i till exempel Hanöbukten om det fanns vindsnurror där ser jag som en olycklig slutsats som stoppar Blekinge Offshore.

Regeringen lyfter i propositionen vikten av att förena energipolitikens tre grundpelare: försörjningstrygghet, ekologisk hållbarhet och konkurrenskraft. Låt mig stanna en stund just vid konkurrenskraften. Betänkandet NU23, som ingen för övrigt var intresserad av att debattera men som det ändå inom kort kommer att beslutas om i kammaren, handlar om elmarknaden. Där har vi en reservation som i högsta grad berör konkurrenskraft.

Herr talman! Jag förstår att jag inte kan lyfta något i det betänkandet, men när det gäller konkurrenskraften vill jag göra riksdagen påmind om att elnäten har betydligt större påverkan på konkurrenskraften än vi kan tro. Privata elnätsföretag tillåts i dag att sätta mycket höga avgifter. Dessutom varierar avgifterna stort över landet, och det kan skilja tusentals kronor per år i avgift beroende på var man bor.

Jag och Vänsterpartiet anser att det är orimligt med så stora skillnader i nätavgifterna som nu råder mellan stad och land, mellan olika regioner och mellan olika bolag. Stegrande elnätsavgifter drabbar inte bara hushållen hårt utan slår även mot industrin och dess konkurrenskraft i förlängningen, och även mot jobben.

Om elnäten skulle ägas av samhället eller regleringen av hur höga ockerpriser elnätsföretag kan ta ut skulle vara bättre skulle den elintensiva industrin bli vinnare, fast den kanske skulle bidra något till kvotplikten i elcertifikatssystemet, vilket den inte gör i dag.

Herr talman! Här passar det utmärkt att jag yrkar bifall till reservation 10 i betänkandet. Vi står givetvis bakom alla våra reservationer, men för tids vinnande yrkar jag bifall bara till den.

Regeringen återkommer många gånger till energiuppgörelsen, som har nämnts här och som slöts mellan regeringspartierna och Centern, Moderaterna och Kristdemokraterna, i texten som behandlar betänkandet. Detta är förståeligt. Den är grundpelaren, och det finns mycket som är bra.

Jag och Vänsterpartiet håller med om många saker som uppgörelsen lyfter; det är viktiga målsättningar och ambitioner. Men jag tycker givetvis att det är olyckligt att Vänsterpartiet är det enda parti som tydligt tar ställning och säger att kärnkraften inte är ett framtida elproduktionsslag som hör hemma på svensk elmarknad, speciellt när vi tar höjd för 100 procent förnybart till 2040.

Herr talman! Avslutningsvis vill jag passa på att tacka talmannen, alla kollegor, oavsett om ni håller med mig eller inte i ett politiskt sammanhang, kanslipersonal i utskottet och här i kammaren och alla andra som gör vårt uppdrag möjligt och givande för ett fint samarbete och önska alla en riktigt fin sommar!

(Applåder)

Anf.  5  MARIA WEIMER (L):

Herr talman! Dagens energidebatt är den sista under den här mandatperioden. Det har varit en händelserik mandatperiod för energifrågorna. På global nivå har vi sett en revolution för förnybar energi. Priserna har fallit och tekniken förbättrats. Solpaneler har spridit sig som en löpeld i soliga länder.

Tyvärr har på vissa håll också en renässans för de fossila energikällorna skett. Vi har sett att Australien öppnar kolgruvor precis i närheten av Stora barriärrevet, som är döende.

Vi fick också uppleva Parisavtalet för klimatet och en offensiv amerikansk politik ledd av president Obama. Nu nedmonteras samma politik av den nye presidenten. Klimatförändringar får inte längre nämnas i officiella amerikanska dokument. Plötsligt framstår Kina och Indien som miljövänner i relation till den amerikanska administrationen. Världen är uppochned.

I Europa har vi jobbat vidare med energiunionen. Tyskland har med sin nya energipolitik fått se hur de egna klimatmålen har fallerat och kolkraften bestått, med eller utan Vattenfalls försäljning av brunkolsgruvorna.

Vi har sett en närmast paneuropeisk debatt för att stoppa den nya gasledningen Nord Stream 2. Efter påtryckningar från riksdagen och EU-nämnden har regeringen gjort viktiga insatser i EU för att försöka stoppa ledningen.

Herr talman! Vad har då hänt i Sverige den här mandatperioden? Regeringen inledde med att höja effektskatten – på förslag från Miljöpartiet, gissar jag. Miljöpartiet gick ju till val på att med politiska beslut stänga kärnkraftsreaktorer enligt tysk modell.

Höjningen av effektskatten fick precis den effekt som Miljöpartiet hade hoppats. Fyra reaktorer fick nämligen stänga i förtid – reaktorer som vi inte kan öppna igen, oavsett hur mycket den elen skulle behövas i Polen eller Litauen eller för att tränga undan fossil produktion på vår nordisk-baltiska elmarknad. Där försvann en del av klimatbidraget.

När regeringen inte reagerade uppstod ett krisläge i energibranschen. Kraftbolag varnade för att fler reaktorer snart behövde läggas ned. Investeringar i renovering lönade sig inte.

Under tiden hade vi i Energikommissionen startat vårt arbete, med siktet inställt på ett långsiktigt beslut. Kärnkraftskrisen gjorde att vårt arbete blev kortslutet och närmast krisartat under våren 2016. Effektskatten behövde hanteras skyndsamt. Regeringen fick hantera en kris som den själv hade skapat.

Förhandlingarna slutade i en dålig kompromiss, som Liberalerna ställde sig utanför. Med ena handen underlättar vi för den kärnkraft och vattenkraft vi behöver genom att sänka skatter. Men med den andra subventionerar vi in elproduktion som vissa partier av politiska skäl gärna vill ha.

Tyvärr formuleras i energiöverenskommelsen ett mål som är helt irrelevant: målet om 100 procent förnybar elproduktion. Vi anser att detta är plakatpolitik. Förnybara energikällor är fantastiska. De ger oss miljövänlig el till bra priser. Men de ska byggas när det behövs och när någon vill betala för det, inte när några politiska partier har skrivit in det i sina valmanifest och bestämmer det. När medel blir till mål blir energipolitiken till pamflett, och då förlorar vi fokus på Sveriges verkliga utmaningar.

En av dessa utmaningar är leveranssäkerheten. Svenska kraftnät presenterade nyligen en rapport som visar oroande siffror. Svensk leveranssäkerhet riskerar att bli sämre än på 70-talet om inga åtgärder vidtas. Elnätet är inför sommaren så bräckligt att det inte säkert skulle klara att någon av de största reaktorerna oplanerat kopplades bort. Därför föreslår Svenska kraftnät nu den drastiska åtgärden att dra ned produktionen i de stora reaktorerna.

Detta visar att vi har stora utmaningar här och nu. Snart blir bekymren allvarligare i och med att fler kärnkraftsreaktorer kommer att stänga ned. Robustheten i elnätet försämras då ännu mer. Detta är en skadlig och kortsiktig energipolitik som kommer att leda till onödiga samhällsekonomiska kostnader.

En annan utmaning är klimatet. Ett av våra energipolitiska mål är hållbarhet. Svensk elexport tränger undan stora mängder fossil elproduktion i våra grannländer. Vi vet att vi därmed med elexporten gör stor klimatnytta. Varje kilowattimme som exporteras innebär en minskad användning av fossila bränslen.

Regeringens politik har lett till att vi förstör den möjligheten. De närmaste åren kommer Sverige i stället att periodvis bli ännu mer beroende av att importera el. Det handlar då om elimport från framför allt fossila källor som kol och gas. Efter att under energiförhandlingarna ha skrutit om svensk elexport kommer energiministern nu att tvingas gå till val med ett nytt energiläge, nämligen att Sverige riskerar att bli mer importberoende. Det är knappast en fjäder i hatten.

Herr talman! Tyvärr saknar energiöverenskommelsen också ett nordiskt och europeiskt perspektiv. Vi borde ha samordnat vårt arbete mycket mer med de nordiska och baltiska länderna, som ju är en del av vår elmarknad. Att fler europeiska länder skapar sin egen energipolitik utan någon som helst samordning med grannländer är totalt verklighetsfrånvänt.

Några steg har tagits på senare år, bland annat genom den rapport som skrivits för Nordiska rådet av finländaren Jorma Ollila. Men det räcker inte. Jag tror att vi måste satsa mycket mer på den här biten, och vi energipolitiker behöver ha lika många europeiska kontakter som vi har kablar som sammanlänkar våra elsystem.

Herr talman! Det råder ingen brist på energipolitiska utmaningar för en ny regering till hösten – den saken är säker.

Jag vill slutligen yrka bifall till reservation 2.

(Applåder)

Anf.  6  PENILLA GUNTHER (KD):

Herr talman! Häromdagen hade vi en debatt om vattenkraften och vattenpolitik. I dag är det energipolitiken i sig. Just häromdagen slog det mig att det var inför valrörelsen 2014 som jag blev uppmärksammad på de problem som många av ägarna till småskalig vattenkraft hade råkat ut för och den godtycklighet som man upplevde att man hade blivit utsatt för i bedömningar av olika miljökrav och därmed förenade kostnader.

Vad jag inte visste då var att jag sedan skulle bli ansvarig för Kristdemokraternas energipolitik och faktiskt jobba med hela energiområdet. Det har varit väldigt spännande och givande både att få sitta i Energikommissionen och att förhandla fram energiöverenskommelsen, som i dagarna firar två år. Genomförandegruppen har jobbat med att förverkliga de intentioner som överenskommelsen gav uttryck för, och därför ställer vi kristdemokrater naturligtvis oss bakom den här propositionen.

Men som när det gäller alla förhandlingar vet vi att man som enskilt parti inte får med allt som man tycker är viktigt. Kristdemokraterna tycker i grunden att det behöver göras en översyn av de energipolitiska subventionerna. Den grundläggande inställningen är att subventioner, i alla fall på sikt, ska riktas till introduktion av ny teknik och inte i all evighet gå till att stötta redan färdigutvecklad teknik.

Att elproduktionssidan riktar om till de sektorer som har de största utsläppen är naturligtvis oerhört viktigt, och därför är det glädjande att se alla dessa färdplaner för ett fossilfritt Sverige som lanserades från olika branscher häromveckan. Det som är speciellt glädjande med färdplanerna är att branscherna själva har medverkat till att ta fram dem, vilket ju borgar för en större förankring och ett förverkligande av dem på ett helt annat sätt än om vi politiker bara skulle ha beslutat åt dem.

Möjligheterna att via information och rådgivning påverka människors beteende i klimatvänlig riktning är en fråga som allmänt borde få en större uppmärksamhet. Det börjar ju med dig och mig. Det börjar med oss, var och en utifrån den situation och de förutsättningar vi har att kunna köpa miljövänliga produkter och att kunna tänka miljövänligt i vår egen process till exempel när vi hanterar avfall hemma, på våra jobb eller var vi nu befinner oss någonstans.

Det är klart att små kommuner har väldigt små möjligheter att ha all expertis. Därför tycker vi att det här kanske borde vara en fråga för Energimyndigheten, som man skulle kunna använda för rådgivning till exempel på så vis att det går att ringa in och ställa frågor.

En sak som jag tycker borde ha fått större uppmärksamhet är den lanserade belysningsutmaningen. Jag lyssnade på P1 i morse, och till min stora glädje lyftes detta initiativ faktiskt upp. Det man kan säga är att det fortfarande är väldigt få som har anslutit sig till denna utmaning.

Därför vill jag rikta mig till statsrådet Ibrahim Baylan och säga att belysningsutmaningen är bra, men jag förstår inte varför man inte har jobbat mer med att försöka få med fler organisationer och företag. Vi hör om Gröna Lund, som byter ut sina lampor till mer energivänliga alternativ och så vidare, men det måste gå att hjälpa många fler med sådana initiativ. Det är ju en energieffektivisering så god som någon. Att bara se det som någonting som stora företag och organisationer ska göra är en helt annan lösning än vad jag som kristdemokrat tror på – jag tror nämligen att vi alla har ett eget ansvar just precis där vi är.

Herr talman! En central del av överenskommelsen är målet om att elsystemet ska vara helt förnybart 2040. Därför tycker vi att det är naturligt att mycket av den energiforskning som finns bör inriktas på att utveckla den förnybara elproduktionen. Samtidigt är det också viktigt att forskningen inte blir så ensidig att man inte tar vara på den teknik och kompetens som finns i dag och som också behöver fortbildning och ny kunskap.

Så länge vi har de kärnkraftsreaktorer vi har måste vi också ha kompetent personal, och vi måste kunna utveckla den energi vi har på ett sådant sätt att vi har kompetent, medveten forskning även kring kärnteknik. Och även om kärnkraften inte skulle bedömas ha någon framtid inom ramen för de principer som vi har fastslagit menar jag att vi ändå inte får stå utan kompetensförsörjningsinsatser för att få personal som fortsätter att jobba inom industrin.

En annan viktig sak är att oavsett energislag krävs det säkra och utbyggda nät. Vi har hört exempel från många olika håll där det saknas utbyggnad för att industrin ska kunna utvecklas. Ett väldigt tydligt och väl framlyft exempel är SSAB i Oxelösund. De har i många olika sammanhang pratat om sina behov, men tillståndsgivningen och kontakten med Svenska kraftnät verkar väldigt långsam. Det är klart att om vi genom energipolitiken ska medverka till en hållbar industri – oavsett om det handlar om stål eller om någonting annat – gäller det ju att även utbyggnaden av näten fungerar.

Herr talman! Till sist skulle jag, precis som min kollega från Centerpartiet, vilja slå ett slag för biogasen. Jag tror att vi skulle kunna utveckla biogasområdet mycket, mycket mer. Det initiativ som har funnits kring biogas håller nu på att fasas ut, och vi måste ta vara på de erfarenheter som har lagts ned i det projektet.

Vi måste också se till att det finns ett organiskt avfall som går att röta och faktiskt göra biogas av. Där finns många goda exempel. Vi har till exempel Biogas Dalsland, som ligger i min valkrets, där man verkligen har tagit till vara avfall från bönderna och gjort biogas av det som också används i närområdet.

Jag tycker att detta är ett lysande exempel på hur man kan använda lokalproduktion hela vägen. Rickard talade om cirkulär ekonomi och ett cirkulärt samhälle; det är precis det som det handlar om.

Jag vill, precis som mina kollegor har gjort tidigare, tacka för denna mandatperiod med energipolitik och många gånger intressanta diskussioner. Man lär sig alltid. Det är väl det som är meningen som politiker: Vi blir aldrig fullärda utan lär ständigt och tar ständigt in av både varandra och andra som vi möter.

(Applåder)

Anf.  7  PATRIK ENGSTRÖM (S):

Herr talman! Som ni säkert hör är jag från Dalarna. Det är en fantastisk plats att leva och bo på. Dalarna är Sveriges tredje största exportlän och det största turistlänet utanför Stockholm, Göteborg och Malmö. Många tänker kanske inte på det.

I Dalarna finns mycket industriproduktion, med bland annat stålverk, sågverk, pappersbruk och en mycket intressant utveckling när det gäller serverhallar. Så här det ut i många delar av landet, och alla är helt beroende av en långsiktig, stabil energipolitik.

Jag har själv jobbat i industrin i 25 år. Jag lovar: Det känns i hela kroppen när man startar ljusbågsugnen i stålverket i Avesta. Det kan liknas vid att vara mitt i ett åskväder. Att smälta 100 ton stål tar ungefär 45 minuter; självklart går det åt mycket energi.

Med den bakgrunden känns det helt fantastiskt att vi nu har satt punkt för 30 år av politisk oenighet om energipolitiken genom en energiöverenskommelse som 75 procent av ledamöterna i Sveriges riksdag står bakom.

När statsminister Stefan Löfven i regeringsförklaringen 2014 bjöd in till blocköverskridande samtal i en energikommission var det en tydlig signal till alla: Vi måste lösa energifrågorna tillsammans.

Till er som har förhandlat fram denna historiska energiöverenskommelse vill jag säga: Bra jobbat!

Detta är bra för landet. Samarbete är nyckeln, inte bara mellan partierna här i Sveriges riksdag. Det handlar också om samarbete mellan alla aktörer på energimarknaden.

Herr talman! Till propositionen finns 15 motionsyrkanden. Från allmänna motionstiden finns 76 motionsyrkanden och nu 36 reservationer. Jag kan konstatera att många motioner har behandlats flera gånger tidigare.

Först vill jag yrka bifall till propositionen och avslag på samtliga motioner.

Energiöverenskommelsen är en gemensam politisk färdplan för en kontrollerad övergång till ett helt förnybart elsystem med nya energipolitiska mål.

Ett robust och tillförlitligt energisystem är en grundläggande förutsättning för ett modernt och väl fungerande samhälle, och jag är stolt över att Sverige på många sätt är ett föregångsland på det energipolitiska området.

Jag är övertygad om att regeringen agerar så kraftfullt som det bara är möjligt för att få genomslag för svenska prioriteringar på energiområdet i Europa. Jag kan också konstatera att regeringen har en kritisk inställning till Nord Stream 2-projektet.

För att nå målen i det klimatpolitiska ramverket och energiöverenskommelsen har elcertifikatssystemet förlängts och ambitionsnivån höjts. De högt satta ambitionerna på området förnybar energiproduktion borgar för långsiktiga regler som gör det möjligt att bygga ut produktionen av förnybara bränslen.

Flera motioner handlar om förnybar elproduktion från vatten, vind och sol. Vattenkraften står för 45 procent av elproduktionen och är extremt viktig.

Svensk Vindenergi bedömer att vindkraftsproduktionen kommer att öka med 60 procent under de kommande fyra åren. Energiöverenskommelsen och den höjda ambitionsnivån samt förlängningen av elcertifikatssystemet är huvudförklaringarna till den ökade utbyggnadstakten.

Regeringen har för avsikt att lämna en proposition om havsbaserad vindkraft under mandatperioden.

Även solenergiproduktionen ökar kraftigt; man kan säga att det pågår en solcellsrevolution i vårt land.

Regeringen stöder utvecklingen på solelområdet på flera olika sätt: via investeringsstöd, skattereduktion och en informationsplattform för solel. Ett förslag på strategi för att öka användningen av solel ska vidareutvecklas under 2018.

Utredningar tittar på hur man ska kunna underlätta för mindre aktörer och hushåll på energiområdet. Det handlar bland annat om skattereduktion, elcertifikat och energilager.

Det finns ett antal motioner som rör energieffektivisering och forskningsområdet. Det pågår ett antal aktiviteter, exempelvis energieffektiviseringsstöd till företag. Sverige ska bli världsbäst på energieffektivisering genom sektorsstrategier, och för närvarande pågår slutförhandlingarna om förändringar i EU:s energieffektiviseringsdirektiv.

En utredning tittar på förenklingar och anpassningar av regelverk och skattelagstiftning för att underlätta för ny produktion och nya tjänster inom bland annat energieffektiviseringssystemet. Man ska även titta på vilka ekonomiska och andra styrmedel – exempelvis vita certifikat – som kan användas för att öka effektiviseringen i energi- och effekthänseende. Ett utredningsbetänkande om energisparlån har dessutom skickats ut på remiss.

Forskning och utveckling är naturligtvis viktigt för att finna lösningar på utmaningar som finns på det energipolitiska området. Fokus ska ligga på forskning och utveckling av förnybar energiproduktion. Samtidigt finns det inga hinder för att medel från andra finansieringskällor används för forskning och utveckling på kärnenergiområdet.

Ett övergripande mål för energipolitiken handlar om försörjningstrygghet. Det handlar om att kraftsystemet ska kunna garantera en säker elförsörjning och tillräcklig effekt i varje givet ögonblick på både kort och lång sikt.

Det handlar också om att kunna överföra el både inom och mellan länder. En fortsatt utbyggnad av elnätet och överföringskapaciteten inom Sverige och till andra länder är av stor betydelse för att säkerställa elleveranserna.

Det är mycket positivt att Sverige har vidtagit åtgärder för att gynna produktionen av biogas. Stödet för svensk biogasproduktion ökas med 270 miljoner under innevarande år. Energimyndigheten har också utlyst medel för utveckling av flytande biogas och inrättat ett innovationskluster.

En utredning om hur biogasens nytta som resurs ska tas till vara på bästa sätt och hur den kan ges konkurrenskraftiga villkor på både kort och lång sikt har tillsatts. Utredningens utfall kan fungera som en biogasstrategi, som flera motioner efterfrågar.

En konkurrenskraftig fjärrvärmesektor är en förutsättning för att vi ska kunna ha framtida el- och värmeförsörjning. Det är viktigt med en gynnsam utveckling där kraftvärmesektorn bidrar med systemvinster för övriga energisystem.

Det ska bli mycket intressant att följa Gotlands färdplan för ett hållbart energisystem, där ny teknik samt nya affärsmodeller och regelverk ska prövas.

Herr talman! Avslutningsvis: Nu måste vi alla vårda energiöverenskommelsen. Vi måste vara beredda att agera utifrån hur verkligheten förändras; jag tänker exempelvis på den snabba teknikutvecklingen.

Jag ser faktiskt stora likheter med Pensionsgruppen, som på något sätt vårdar pensionssystemet.

När pensionssystemet infördes var det ingen som kunde föreställa sig att medellivslängden skulle öka så snabbt som den gör i Sverige. Detta är naturligtvis helt fantastiskt. Men då sätts gamla sanningar på ända, och då krävs det att politiken agerar och tar nödvändiga beslut.

Låt oss nu vårda energiöverenskommelsen så att vi kan leverera en långsiktig, stabil energipolitik i många år framåt.

(Applåder)

 

I detta anförande instämde Mattias Jonsson, David Lindvall, Karl Längberg, Anna-Caren Sätherberg och Anna Wallén (alla S).

Anf.  8  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik:

Herr talman! Patrik Engström lyfte själv i sitt anförande fram industrins betydelse för hans hemlän Dalarna.

Tillverkningsindustrin präglas i allt högre grad av automation och är beroende av att el finns tillgänglig. Stålindustrin och all energiintensiv industri i Sverige är otroligt beroende av att det finns god tillgång på el under årets alla timmar. Även kommande industrietableringar, som serverhallar vilka skulle kunna bli omfattande i Sverige, men även stora delar av vår välfärd, till exempel våra sjukhus, är väldigt beroende av att el finns tillgänglig.

I anförandet lyfter Patrik även fram betydelsen av försörjningstryggheten för industrin. Men det som är problematiskt är att det inte finns något mål för försörjningstryggheten, som är en av grundpelarna. Man har slagit ifrån sig och vill inte ha något mål.

Därför, herr talman, skulle jag vilja fråga varför Socialdemokraterna tycker att det är dåligt att ha ett mål för leveranssäkerheten.

Anf.  9  PATRIK ENGSTRÖM (S) replik:

Herr talman! Tack för frågan, Mattias Bäckström Johansson!

Om vi ska ha ett mål för leveranssäkerhet av el, går vi då inte tillbaka till en mer reglerad elmarknad? Är det detta som Mattias Bäckström Johansson efterfrågar? I så fall: Är det verkligen bra?

Om vi har en elmarknad som är reglerad utifrån tillgång och efterfrågan känns det som att vi har byggt in många mekanismer som kan vara väldigt bra för elmarknaden. Jag skulle vilja veta om det som Mattias Bäckström efterfrågar är att vi ska reglera elmarknaden ytterligare.

Anf.  10  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik:

Herr talman! Med det elcertifikatsystem som infördes vid millennieskiftet bestämmer man redan i dag på politisk väg vad som ska byggas. Under den här regeringen har även bidragen till investeringar i solkraft ökat, så marknaden som sådan är i allra högst grad politiskt reglerad.

Problemet blir lite att allas ansvar är ingens ansvar. Det har fungerat hittills därför att det under lång tid har funnits en modell för att hantera det här industriellt. Den svenska industrin har haft en komparativ konkurrensfördel utifrån att vi har haft kärnkraften som en planerbar kraftproduktion och en stor andel vattenkraft som reglerkraft som även har möjliggjort integrationen av väderberoende elkraft. Men nu försvinner ju den planerbara kraftproduktionen alltmer.

Även Svenska kraftnät som statlig expertavdelning flaggar för att detta inte kommer att hålla. Det kommer att bli ett stort antal timmar då man inte fixar kraftbalansen. Det kommer att vara nästan en halv månad varje år i södra Sverige då det inte finns tillgång till el. Hur ska industrin kunna konkurrera på en global marknad under sådana förutsättningar? Den konkurrensfördel som man har haft försvinner ju nu.

Därför är det svårt att förstå varför man inte vill titta på det här. Det handlar ju inte bara om elproduktion utan också om distribution, att det ska fungera med elnäten. Detta finns det ingen myndighet som har det samlade ansvaret för. Det finns inget mål för leveranssäkerheten. Eftersom ingen har ansvar för den finns det nog stor anledning att tro att det här inte kommer att lösa sig långsiktigt.

Jag tycker fortfarande att Patrik är svaret skyldig på frågan varför man tycker att det är så dåligt att ha ett sådant mål och om ni tror att det här kommer att lösa sig självt. I så fall vore det intressant att få svar på frågan: Tror ni att Svenska kraftnät har fel? Vad är det för fel Svenska kraftnät gör i sin bedömning om det inte finns anledning att oroa sig över leveranssäkerheten?

Anf.  11  PATRIK ENGSTRÖM (S) replik:

Herr talman! Det finns självklart ingen anledning att betvivla Svenska kraftnäts utredning. Men det är väl bra att Svenska kraftnät flaggar för de utmaningar som vi trots allt ser.

Precis som Mattias Bäckström Johansson säger står vi inför stora utmaningar på grund av att energisystemet omdanas och byggs om. Vi går från stora leverantörer till en mer differentierad produktionskedja, och naturligtvis leder det till utmaningar. Det är bra att Svenska kraftnät och andra flaggar för att här kan det bli bekymmer, för då har vi politiker och andra möjlighet att agera – eller hur?

Återigen: Ska vi inte ha en flexibel elmarknad utifrån tillgång och efterfrågan? Jag tycker att det i grunden är väldigt bra. Och om vi skulle införa ett leveranssäkerhetsmål, som Mattias Bäckström Johansson efterfrågar, var finns då flexibiliteten? Då skulle vi gå tillbaka till någonting som vi har haft förut, och det tror jag vore dåligt.

(Applåder)

Anf.  12  RICKARD NORDIN (C) replik:

Herr talman! Jag glömde mitt yrkande när jag var uppe i talarstolen tidigare, så jag skulle gärna vilja yrka bifall till reservationerna 9 och 26.

Över till repliken: De hus som byggdes ungefär när min mormor föddes, vilket är ganska många hus i Sverige, kan ha värmts upp med först ved, sedan kol, olja, direktverkande el och sedan kanske över till fjärrvärme och slutligen tillbaka till el eller till och med till biobränsle i form av pellets eller något annat. Det visar att under ett hus livslängd pågår väldigt många förändringar. Därför är det viktigt att ha ett bra klimatskal och inte bara fokusera på hur den energi som huset använder produceras.

I energiöverenskommelsen står det: En konkurrenskraftig fjärrvärmesektor och minskad elanvändning i uppvärmningen är förutsättningar för att klara den förnybara el- och värmeförsörjningen kalla vinterdagar.

I Energikommissionens slutbetänkande, som Socialdemokraterna och Centerpartiet tillsammans med flera andra partier förhandlade fram, står det att systemgränsen för byggnaders energiprestanda, Boverkets byggregler och definitionen för nära-nollenergihus bör fokusera på använd energi i stället för levererad eller köpt energi.

I Miljömålsberedningen, vars slutbetänkande vi också var med och förhandlade fram och som även Socialdemokraterna skrev under, står det att byggreglerna bör vara neutrala för valet mellan el och fjärrvärme genom att fokusera på använd energi snarare än köpt energi. Så, Patrik Engström, varför har regeringen inte åtgärdat det här problemet?

Anf.  13  PATRIK ENGSTRÖM (S) replik:

Herr talman! Tack, Rickard, för frågan!

Jag har inte deltagit i förhandlingarna, så jag har naturligtvis svårt att återge hur förhandlingarna har gått till. Statsrådet är i salen och kan möjligtvis svara på frågan. Men jag kan inte redogöra för varför det ser ut som det gör i dag.

Det här är den sista energidebatten i kammaren den här mandatperioden, och varken jag eller Rickard vet vad som händer och om vi kommer att finnas kvar i kammaren efter valet.

Jag kan konstatera att vi har kommit i mål med en energiöverenskommelse som jag personligen är väldigt glad och stolt över. Att vi nu står här och debatterar en detalj i ett större sammanhang visar på att vi är överens om de stora frågorna, och det tycker jag är väldigt positivt.

Rickard undrade i sitt anförande om Socialdemokraterna och Miljöpartiet står upp för energiöverenskommelsen även på sikt. Jag kan meddela Rickard att vi inte har för avsikt att förlora valet. Vi kommer att fortsätta att regera, så utifrån det perspektivet kan Rickard vara lugn.

Långsiktiga överenskommelser som vi har träffat gemensamt kommer vi naturligtvis att vårda.

(Applåder)

Anf.  14  RICKARD NORDIN (C) replik:

Herr talman! Nu är det Patrik Engström och ingen annan som representerar Socialdemokraterna, och det var Patrik Engström som jag frågade varför man inte har agerat. På detta finns det uppenbarligen inget svar.

Om Patrik Engström och Socialdemokraterna tycker att Boverkets byggregler är en detalj i sammanhanget tror jag att de har mycket att lära av energidebatten och om vad kraftvärmebranschen önskar, för det här är ingen detalj. Det är verkligheten, och det är ett genuint problem.

Med tanke på hur det fungerar en kall vinterdag är det just eluppvärmningen av byggnader som är ett av de stora problemen. Men man har missat vad som är framtidens problem och stirrar sig blind på vad som finns i dag, och där är inte detta en detalj. Det är en avgörande fråga.

Nej, Patrik Engström, du var inte med och förhandlade. Men jag redogjorde för förhandlingens resultat, för precis det som vi var överens om. Därför är du svaret skyldig på frågan: Varför agerar inte regeringen och ändrar Boverkets byggregler? Det är Socialdemokraterna som sitter i regeringen och det är Socialdemokraterna som har statsrådet. Varför gör ni ingenting? Det här är inte en detalj; det är en av de viktigaste frågorna för hela kraft- och fjärrvärmebranschen.

Anf.  15  PATRIK ENGSTRÖM (S) replik:

Herr talman! Jag konstaterar att jag inte kan svara på den frågan.

Jag drar mig till minnes att Rickard Nordins parti har en motion i betänkandet om vedspisar och sådant – det används ett annat uttryck i direktivet. Det handlar om prestandan på vedspisar.

Jag uppfattar att Centerpartiet utifrån ett klimatperspektiv driver på för att gamla vedspisar ska bytas ut. Jag är dock inte säker på att det är rätt väg att gå när det gäller uppvärmning av fastigheter. Men på sikt, allteftersom vedspisar byts ut, ska de givetvis hålla den standard som nya rön kräver. Men att i dag kräva att äldre vedspisar byts ut är en märklig hållning.

(Applåder)

Anf.  16  LISE NORDIN (MP):

Herr talman! Det har varit en resa fram till det förslag om energipolitikens inriktning vi nu debatterar och senare har att besluta om.

För sju år sedan, 2011, lade Miljöpartiet fram det första förslaget om 100 procent förnybar energi i form av en riksdagsmotion. Vi beräknade potentialen för vindkraft, solenergi och energieffektivisering ihop med befintlig vattenkraft och bioenergi och lade fram ett konkret förslag till riksdagen om ett helt förnybar el- och värmesystem till år 2030.

Dåvarande regering svarade att det inte var möjligt och avfärdade samtidigt förslaget att Energimyndigheten skulle få utreda ett helt förnybart energisystem. Till slut valde Energimyndigheten att själv tillsätta en utredning om 100 procent förnybar energi, och bollen var i rullning.

När den nya regeringen bildades 2014 av Socialdemokraterna och Miljöpartiet presenterades målet att Sverige skulle ha 100 procent förnybar energi på sikt.

Reaktionerna från omvärlden var tydliga. Sverige steg i internationell rankning över länders attraktivitet för investeringar i förnybar energi, med hänvisning till den nya regeringens politiska mål.

Därefter inleddes arbetet i Energikommissionen med riksdagens partier, som i juni 2016 resulterade i att fem partier, Socialdemokraterna, Moderaterna, Miljöpartiet, Centerpartiet och Kristdemokraterna, enades om en gemensam politik för en kontrollerad övergång till ett helt förnybart energisystem. De två målen är 100 procent förnybar elproduktion till år 2040 och 50 procent effektivare energianvändning till år 2030. Överenskommelsen är viktig för att ge branschen de långsiktiga spelregler den länge har efterfrågat.

Sveriges kärnkraft byggdes på 70- och 80-talen och börjar bli gammal. Man har beslutat att fyra av tio reaktorer ska stängas under denna mandatperiod. Snittåldern på de fyra som stänger är 43 år. Kärnkraftsägarna pratar nu om en teknisk livslängd på 60 år, vilket skulle ge drift till runt 2040. Mycket talar dock för att de kommer att stängas tidigare av ekonomiska och tekniska orsaker.

Oavsett om det blir stängning 2030 eller 2040 är frågan vad som ska ersätta kärnkraftselen. Kärnkraften har tre problem: uranbrytning för att få bränslet, säkerhetsrisker, med Tjernobyl och Fukushima som avskräcker, och behov av slutförvar av avfallet, som måste hållas avskilt från människor i över hundra tusen år.  Att bygga kärnkraft är också dyrt. Med förnybar energi får vi ett säkrare, billigare och mer långsiktigt hållbart elsystem.

Utvecklingen av förnybar energi är en ständig källa till goda nyheter. Globalt är investeringarna i förnybar el dubbelt så stora som investeringarna i traditionell kraftproduktion. I USA arbetar nu fler människor i solcellsindustrin än inom kol, olja och gas sammantaget.

Historien visar att uppsatta energi- och klimatmål oftast nås lättare än vad man trodde när man satte målen. Vi minns när dåvarande energiminister Maud Olofsson 2008 förhandlade ned Sveriges åtagande i det EU-gemensamma förnybarhetsmålet till 2020 från 50 till 49 procent. Målet kallades ambitiöst men inte omöjligt.

I dag, två år innan målet ska uppnås, ligger vi redan långt över. Utvecklingen med miljöteknik går snabbare än tidigare beräknat. Det är en viktig erfarenhet för oss politiker att ta med oss när vi planerar för framtiden.

I Sverige sätter vindkraftsutbyggnaden rekord, mycket tack vare den förlängning av elcertifikatssystemet som de fem partierna enades om och beslutade om i riksdagen för ett år sedan.

En annan inspirerande nyhet är att energibolagen i Sverige tävlar om att bygga den största solcellsparken. Förra veckan meddelade Göteborg Energi att man ska bygga en solcellspark på fem megawattimmar, och Ekot rapporterade om detta. Bara några dagar senare kom nyheten att Affärsverken i Karlskrona ska bygga en solcellspark på sex megawattimmar, som därmed blir Sveriges största. Det är tydligt att vi står mitt i en energirevolution.

I dag talar både ekonomiska argument och miljöargument för förnybar energi. Politiken har en viktig roll i omställningen. Fem partier har nu enats om målet 100 procent förnybar elproduktion till år 2040. I överenskommelsen fastslås att det är ett mål. Det är inte ett stoppdatum som förbjuder kärnkraft, och det innebär inte heller en stängning av kärnkraft med politiska beslut.

För att nå målet om 100 procent förnybar el ska förnybar energi ersätta kärnkraft och fossil elproduktion. Vägen dit går dock inte via att riksdag eller regering beslutar om vilken reaktor som ska stänga när.

När Barsebäcks två reaktorer stängdes 1999 och 2005 användes den så kallade avvecklingslagen som innebär just ett sådant politiskt beslut med så kallat stoppdatum. Konsekvensen av att stänga kärnkraft med politiskt beslut är att det innebär att stora skadeståndsbelopp ska betalas ur statskassan; det är dyrt. Fram till 2017 betalades miljardbelopp ur statskassan i ersättning till ägarna av Barsebäck.

För Miljöpartiet är det ingen klok strategi, och vi har därför inte förordat ett införande av en ny avvecklingslag. Det är inte skattebetalarna som ska betala.

Låt mig också rätta Liberalernas Maria Weimer som sa att Miljöpartiet gick till val på att stänga kärnkraften med politiska beslut. Nej, i vårt valmanifest står det att flera reaktorer ska stängas under mandatperioden och att målet bör vara 100 procent förnybar elproduktion.

Det är precis detta som nu händer. Vägen till 100 procent förnybar elproduktion går via att kärnkraften betalar mer för sina samhällsekonomiska kostnader och att vi satsar på förnybar energi och energieffektivisering.

Beräkningarna från Energimyndigheten, som redovisas i propositionen, visar att andelen förnybar el beräknas uppgå till mellan 76 och 83 procent år 2040, beräknat utifrån dagens styrmedel. Det kvarstår alltså ett glapp på ca 20 procent för att vi ska uppnå målet till 2040.

Alla partier som står bakom målet om 100 procent förnybar elproduktion har att svara på hur man vill att målet ska uppnås. Flera delar presenteras i energiöverenskommelsen. Jag nämnde förlängningen av elcertifikatssystemet, vilket ger en tydlighet för fortsatta investeringar i förnybar elproduktion. Vidare har riksdagen i veckan beslutat om moderna miljövillkor för vattenkraften och höjt skadeståndsansvaret för kärnkraften från 3 miljarder till 12 miljarder kronor. Kvar för partierna att enas om före valet är slopad anslutningsavgift för havsbaserad vindkraft.

Självklart finns det utmaningar i att nå ett 100 procent förnybart elsystem, och fokus behöver vara på den bästa vägen att nå målet. Det är enligt Miljöpartiet viktigt att tidigt planera för omställningen för att göra den på ett så smart och kostnadseffektivt sätt som möjligt. Att vänta tills behoven blir akuta är sannolikt dyrare än att ha marginaler.

Två kärnkraftsreaktorer har stängt ned under mandatperioden, och två till ska stänga före 2020 efter beslut från kärnkraftsägarna. Dessa fyra reaktorers bortfall kompenseras med råge av att det har byggts upp en buffert med förnybar energi sedan tidigare. Sverige bör fortsätta att ha ett överskott av förnybar el för att ha en beredskap när de kvarvarande reaktorerna stänger.

Den kanske största utmaningen i energiomställningen till mer väderberoende förnybar el som sol- och vindkraft är den så kallade effektfrågan. Den finns olika tekniska möjligheter för att lösa effektutmaningen. Det kan handla om energilagring, efterfrågeflexibilitet eller ökad sammanlänkning med elkablar till grannländerna. Politikens uppgift är att säkerställa att de nya lösningarna kan växa fram när behoven av effektåtgärder uppstår.

Att omställningen till 100 procent förnybar el kommer att kosta är självklart. Men den naturliga följdfrågan är vad kostnaden för alternativet är. Investeringsbehovet är stort då nästan 100 terawattimmar i årsproduktion kommer att läggas ned fram till mitten av 2040-talet på grund av anläggningarnas livslängd. Den finns olika vägar, men allt pekar på att det förnybara alternativet är det billigaste.

I dag finns det bara två länder i vår närhet som bygger ny kärnkraft – Frankrike och Finland – och båda projekten avskräcker med stora förseningar och kostnader. I Storbritannien har staten lovat ett garanterat pris på 1 krona per kilowattimme för den som vill bygga ny kärnkraft, men hittills är det oklart om någon kommer att anta detta erbjudande.

Erfarenheterna i vår omvärld visar att kärnkraft kostar 1 krona per kilowattimme. Jag har i tidigare debatter ofta sagt att vi bygger vindkraft för halva den kostnaden, men jag behöver nu uppdatera mina siffror. Beskedet från den norska energimyndigheten i går var att de räknar med att bygga landbaserad vindkraft för 26 öre per kilowattimme år 2020. Det innebär att man får fyra gånger så mycket el för pengarna om man satsar på förnybart i stället för ny kärnkraft.

Det är bra för Sverige och världen att vi nu antar ett mål om 100 procent förnybar elproduktion.

Herr talman! Detta är min sista debatt som riksdagsledamot, och jag ber att få tacka alla representanter för partierna som jag har haft många och långa möten och diskussioner med. Tack för allt engagemang!

Avslutningsvis vill jag yrka bifall till propositionen.

(Applåder)

Anf.  17  RICKARD NORDIN (C) replik:

Herr talman! Det vore synd att inte ta chansen att få en sista debatt tillsammans med min namne.

Jag tänkte börja med att säga att jag handlar el hemma, som konsument. Jag köper vattenkraftsel i dag. Men det är inte vattenkraftsel som kommer ur mina uttag i Göteborg, utan det är Göteborgs Energis el, som produceras tvärs över motorvägen, som kommer till mig.

När det gäller ursprungsgarantier säger Energimyndigheten att en elleverantör som vill sälja exempelvis el från vindkraft eller vattenkraft kan göra detta på två olika sätt, antingen genom att annullera ursprungsgarantier från egna vindkraftverk eller vattenkraftverk eller genom att köpa in ursprungsgarantier från en sådan producent och annullera dessa, det vill säga ta bort dem, i samband med att leverantören säljer elen till slutkunden.

Då blir min fråga till Lise Nordin: Är det rimligt att man som producent som säljer el får marknadsföra detta till kunder – företagare och konsumenter – som köper el som är producerad på ett sådant sätt och annullerad med certifikat?

Anf.  18  LISE NORDIN (MP) replik:

Herr talman! Rickard Nordin lyckas med konststycket att även i detta replikskifte lyfta in en fråga som inte är en del av det mycket omfattande betänkande som vi har att debattera. Men han får självfallet lyfta in alla sorters energifrågor som kan engagera, och det här är förstås en av dem.

Ursprungsgarantier och hur de ska få användas i marknadsföring är en fråga som, vad jag vet, inte har hanterats politiskt i riksdagen under denna eller tidigare mandatperioder, men jag har förstås sett att det finns en debatt. Som Miljöpartiets energipolitiska talesperson har jag uttryckt att det är rimligt att företag som producerar sin egen el eller köper en viss sorts förnybar el ska kunna få använda rättigheternas ursprungsgarantier som en del i sin marknadsföring och få kommunicera att det är denna el de använder i sin produktion.

Anf.  19  RICKARD NORDIN (C) replik:

Herr talman! Detta är en energidebatt. Ursprungsmärkning och ursprungsgarantin är en otroligt viktigt del av vår energisektor.

Det är bra att Lise Nordin tycker precis samma sak som Centerpartiet. Men kan Lise Nordin och Miljöpartiet svara på varför regeringens egna myndigheter, i detta fall Konsumentverket, agerar precis tvärtemot? Det är ju ni som styr era myndigheter, affärsverk och annat, och detta system anses inte fungera. Vad har gjorts för att säga till Konsumentverket eller för att ändra lagstiftningen så att Konsumentverket inte agerar på detta sätt?

Anf.  20  LISE NORDIN (MP) replik:

Herr talman! Rickard Nordin frågade mig vad regeringen har gjort för att styra sina myndigheter. Jag ber att få påminna om att det inte skulle vara tillåtet för exempelvis energiministern att ringa till en myndighet och säga vad de ska göra, utan vi har en lagstiftning som beslutas i denna kammare.

Om Centerpartiet hade haft ett konkret förslag och inte bara använde det retoriskt i denna debatt hade riksdagen kunnat besluta om en sådan lagstiftning, om det fanns majoritet för förslaget. I form kan regeringen inte ringa myndigheterna och säga vad de ska göra. Men vi kan självfallet ändra lagstiftningen om det finns ett behov av det.

Jag tror dock att det i denna fråga kanske inte är nödvändigt med en förändrad lagstiftning, utan det kan räcka med att vi får en diskussion som handlar om hur man ska se på ursprungsgarantier. Jag konstaterar att jag, trots Rickard Nordins höga tonfall i denna fråga, inte har sett något konkret förslag.

Med detta sagt skulle jag vilja avsluta med några reflektioner om det vi har att besluta om och debattera i dag – energipolitikens inriktning. Jag är glad att Centerpartiet också ställer sig bakom målet om 100 procent förnybar elproduktion. Jag vet att de i sitt valmanifest hade en mer generell formulering om förnybar energi. Vi har nu fått enighet om en långsiktig energipolitik, och detta tror jag är viktigt för Sverige, efter så många år av debatt om denna politik.

Rickard Nordin sa i sitt anförande en hel del om vad Centerpartiet ska ha drivit i energiförhandlingarna. Vi kan självfallet inte referera här vad som sägs i förhandlingar – vi har inget protokoll – men jag tycker att det är viktigt att partierna före förhandlingarna deklarerar vad de driver för politiska förslag, så att väljarna sedan kan utvärdera.

Jag är glad att vi enades om 100 procent förnybar energi och att Centerpartiet nu också kommer att rösta för den proposition som vi har att debattera och besluta om.

(Applåder)

Anf.  21  Statsrådet IBRAHIM BAYLAN (S):

Herr talman! Kära ledamöter! I dag är en historisk dag för Sverige. Med denna debatt och den kommande voteringen om propositionen Energipolitikens inriktning kommer vi att lämna fruktlösa politiska låsningar bakom oss.

Svensk energipolitik har nått ett nytt, stabilt läge – ett läge där vi tillsammans, över blockgränserna, tar ansvar för att säkra stabil tillgång till el som har konkurrenskraftiga priser och som produceras på ett sätt som inte förstör vår miljö eller vårt klimat. Vi kommer därmed att lämna en 40 år lång debatt om svensk energipolitik bakom oss – en politik som vi har sett skuggor av också i denna debatt.

Att vi lyckas komma samman och ta gemensamt ansvar för en så viktig fråga som tillgången till energi är en sann styrka för vårt land. I en tid där omvärlden kan kännas alltmer orolig och politiken alltmer fokuserar på olikheter visar vi att samarbete är möjligt också i frågor som är laddade och att samarbete är en styrka och en tillgång för ett land. Vi visar att politik inte enbart är att vilja förändra utan att politik framför allt handlar om att se till att förändringen blir av.

Tillgång till energi är en grundförutsättning för ett modernt samhälle. Tillgång till el och energi ger oss möjlighet att bygga bättre samhällen för våra medborgare och gav oss också hela den industriella revolutionen, med allt vad den inneburit när det har gällt att bygga framgångsrika samhällen.

Herr talman! Redan under 1970- och 1980-talen började vi så smått förstå att vårt sätt att utvinna och använda energi också har en baksida. Miljö, klimat, hälsa och säkerhet påverkas av vårt sätt att utvinna och använda energi. I dag, år 2018, kommer två tredjedelar av världens klimatgasutsläpp från energisektorn – två tredjedelar. Det betyder att vi inte kommer att klara klimatutmaningen om vi inte ställer om energisektorn.

Herr talman! Ibland när vi får rapporter om smältande polarisar, om försvagad golfström, om torka och om alltmer våldsamt väder kan det te sig som aningen hopplöst. Men jag skulle nog säga att när man tittar på den utveckling som vi har i dag börjar vi nu skönja de lösningar som kommer att hjälpa oss att ställa om. Det handlar inte bara om att det är möjligt. Det som är det fantastiska på senare år är att det som är tekniskt möjligt håller också på att bli det ekonomiskt kloka att göra. Det är en fantastisk utveckling, där solel nu är det mest konkurrenskraftiga sättet att producera energi i många soliga delar av världen. Vindkraften är, precis som vi hörde, alltmer konkurrenskraftig i de delar av världen där solel i dag inte är det. Kostnaderna har också sjunkit dramatiskt när det gäller lagring av el och energi.

Herr talman! Detta ger oss helt nya förutsättningar att ta nästa kliv och se till att lösa de behov som våra industrier och våra medborgare har, men göra det på ett sätt som inte förstör miljön och klimatet.

Det var med denna utgångspunkt som statsminister Stefan Löfven i sin första regeringsförklaring lovade att bjuda in till en bred energiuppgörelse. Han såg både behovet av att avsluta den decennielånga diskussionen i Sverige om kärnkraftens vara eller icke vara och behovet av att säkra el och energi till våra industrier och hushåll på ett sätt som inte förstör vårt klimat och vår hälsa. Han gjorde det för att våra medborgare och våra företag alltid ska ha tillgång till den energi som de behöver när de behöver den.

Våren 2015 startade arbetet med Energikommissionen. Samtliga riksdagspartier bjöds in, och en parlamentarisk arbetsgrupp bildades. Jag läser ur uppdraget:

”Energikommissionens uppdrag är att se över det framtida behovet av energi utifrån aktuell och befintlig forskning. Kommissionen ska identifiera vilka utmaningar och möjligheter som finns för den framtida energiförsörjningen. Elförsörjningen är en viktig fråga för Sveriges utveckling och konkurrenskraft. Därför har kommissionen ett särskilt fokus på el. Uppdraget är att lämna ett underlag till en bred politisk överenskommelse om energipolitikens inriktning, med fokus på 2025 och framåt.”

Vi bedrev arbetet med öppenhet och hade som målsättning att utgå från fakta och forskning snarare än tyckande och redan befästa ståndpunkter.

Herr talman! Många var med: energisektorn, miljöorganisationer, näringsliv och industri samt politiker från alla partier. Ibland kändes det verkligen som att vi bedrev ett stort samhälleligt grupparbete tillsammans. Det fanns ett gemensamt tryck efter förändring, en gemensam vilja, och det blev resultat.

Sommaren 2016 nådde vi en politisk överenskommelse. I juni 2016 kunde regeringen, Moderaterna, Centerpartiet och Kristdemokraterna presentera en historiskt bred energiöverenskommelse. Vi var och är överens om att Sverige ska ha ett robust elsystem med hög leveranssäkerhet, en låg miljöpåverkan och el till konkurrenskraftiga priser. Detta skapar långsiktighet och tydlighet för marknadens aktörer och bidrar till nya jobb och investeringar i Sverige.

Energiöverenskommelsen täcker många områden: produktion, överföring och användning av el. Framför allt innehåller den centrala mål för energipolitiken.

De centrala mål som vi sommaren 2016 formulerade i en politisk överenskommelse är vi i dag här för att debattera och fatta beslut om med anledning av just denna proposition, Energipolitikens inriktning.

Det handlar om 100 procents förnybar elproduktion 2040, 50 procents effektivare energianvändning till 2030 och de tre pelare som energipolitiken ska bygga på.

Herr talman! Varför är denna proposition historisk och viktig för Sverige? Jo, det är den för att den innehåller mål som kommer att forma svensk energipolitik många år framöver. Försörjningstryggheten, konkurrenskraften och den ekologiska hållbarheten är de pelare som den bygger på, men också riktningen med 100 procents förnybar elproduktion.

Herr talman! Man försöker här i debatten göra detta till en gammal vanlig träta om kärnkraftens vara eller icke vara. Men verkligheten är att vi har en fantastisk teknisk revolution, inte bara för solel och vindkraft utan också för lagring och för smarta nät. Och antingen är man med och leder denna utveckling eller också hamnar man bakom.

Herr talman! Lägg därtill kärnkraftsägarnas egna besked om att de med goda förutsättningar ser framför sig att de kan driva de nuvarande kärnkraftverken till ungefär 2040.

Herr talman! Den politik som vi nu slår fast är inte bara realistisk. Det är också den mest troliga utvecklingen med den kostnadsbild som vi har framför oss.

Visst finns det utmaningar. Hade de inte funnits hade vi inte behövt någon kommission och en uppgörelse. Det är just dessa utmaningar som vi nu tar oss an. Och när Sverige gör det är det bra inte bara för klimatet. Det kommer också att vara bra för den ekonomiska tillväxten och jobbskapandet i detta land.

Herr talman! Därför vill jag avsluta med att rikta ett stort tack till alla de partier, näringslivsorganisationer, företag, miljöorganisationer och energisektorer som har deltagit på ett seriöst och kompetent sätt och bidragit till att se till att vi har denna historiska överenskommelse.

Dessutom vill jag under mandatperiodens sista energipolitiska debatt rikta ett särskilt tack till de ledamöter som var med och förhandlade fram energiöverenskommelsen: Åsa Westlund från Socialdemokraterna, Lise Nordin från Miljöpartiet, Lars Hjälmered från Moderaterna, Rickard Nordin från Centerpartiet och Penilla Gunther från Kristdemokraterna. Tillsammans har vi visat på styrkan i att samarbeta över blockgränserna. Vi har tillsammans visat att politiken både kan och har tagit ett ansvar för de riktigt svåra frågorna och för det som är Sverige och Sveriges utveckling. Det är inte alltid lätt – snarare tvärtom. Mycket i politiken i dag drar åt ett annat håll, nämligen att man ska träta och gräla på varandra. Det är det som ger likes och tummen upp på sociala medier. Men vill man åstadkomma resultat, då slåss man för sin övertygelse och går in i en förhandling. Ofta, ska jag tillstå, herr talman, är det tuffa förhandlingar. Men man är också beredd att pragmatiskt, som vi hörde tidigare, komma framåt och hitta lösningar. Detta har vi gjort i dag.

Jag är mycket glad att säga detta igen: I dag är en historisk dag. Vi kommer att besluta om nya energipolitiska mål som kommer att forma svensk energipolitik för lång tid framöver. Det är bra för landet. Det är bra för klimatet. Det är bra för ekonomin.

(Applåder)

 

I detta anförande instämde Patrik Engström, Mattias Jonsson, Karl Längberg, David Lindvall och Anna-Caren Sätherberg (alla S).

Anf.  22  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik:

Herr talman! Jag hade egentligen tänkt inleda med en annan fråga till statsrådet. Men jag blev aningen förvånad över delar av statsrådets anförande och som kanske vittnar om att det finns kunskapsluckor om hur saker förhåller sig. Det som delvis lyfts fram är argumentationen om att vi inte kommer att klara en klimatutmaning om vi inte ställer om vår energisektor. Det är någonting som är sant på global och europeisk nivå, men det är inte sant på svensk nivå.

Den genomsnittliga utsläppsnivån globalt sett är ungefär 528 gram CO2-ekvivalenter per kilowattimme. I Europa ligger nivån på nästan hälften av det, och i det nordiska perspektivet ligger nivån på bara en tiondel. Sverige har en nivå som motsvarar 4 procent av nivån globalt sett; den är 96 procent lägre. Då är frågan om statsrådet på allvar tror att utsläppen av växthusgaser över huvud taget kommer att minska med ett mål om 100 procent förnybart.

Anf.  23  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! Jag måste säga att det var den konstigaste frågan jag fått i den här kammaren, Mattias Bäckström Johansson.

Att energisektorn bidrar till klimatgasutsläppen är allmänt vedertaget. Att det globalt är så att två tredjedelar av alla klimatgasutsläpp kommer från energisektorn är sant. Det är också sant att vårt elsystem är världens näst mest koldioxidsnåla – men vi har en transportsektor som fortsätter att släppa ut stora mängder. Även om Sverige har den högsta andelen förnybar energi i transportsektorn utgör den bara 20 procent; 80 procent är fossil energi.

Att vi har industrier, inte minst stålindustrin, som släpper ut stora mängder koldioxid är också sant. Något annat som är sant, och väldigt glädjande, är att dessa industrier till skillnad från Sverigedemokraterna är oerhört progressiva. De går nu in och ser det som en viktig del av deras affärsmodell att faktiskt ställa om och hitta lösningar på problem som har funnits under lång tid. Därmed stärker de också sin konkurrenskraft, inte bara genom billigare energi utan även som en del av sin produktreklam.

Vår elsektor är alltså väldigt koldioxidsnål – visst, den är världens näst mest koldioxidsnåla – men att vår energisektor fortsatt släpper ut väldigt stora mängder koldioxid är ett faktum. Att ens behöva svara på en fråga av den karaktären från en energipolitisk talesperson förvånar mig faktiskt.

(Applåder)

Anf.  24  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik:

Herr talman! Det är ju rätt påtagligt att det svenska kraftsystemet inte har någon potential att nå mycket lägre. Tvärtom innebär den energi som regeringen vill tillföra större utsläpp av växthusgaser per producerad kilowattimme. Det kommer att leda till att utsläppen av växthusgaser från den delen av kraftsektorn kommer att öka. Det gör det till en chimär att i sammanhanget prata om det utifrån ett svenskt perspektiv, då det inte är en sanning. Sverige har redan ett fossilfritt kraftsystem som har väldigt liten påverkan i termer av utsläpp av växthusgaser, och det ska man fortsatt vårda och värna. Vi har absolut inget emot att man når fossilfrihet inom andra delar av industrin.

Problemet uppstår väl när man vill skilja ut detta och ha just 100 procent förnybart som mål bara inom energipolitiken när det annars inom miljöarbetet i stort är fossilfrihet som är målbilden. Vi tycker att det är högst olyckligt att man vill avgränsa det på det här sättet. Problemet är också att man ser målbilden som någonting som leder till ett elsystem som kommer att präglas av högre leveranssäkerhet. Vi från Sverigedemokraterna har väldigt svårt att se på vilket sätt mer väderberoende kraftproduktion skulle leda till högre leveranssäkerhet.

Vi har redan under den här mandatperioden skiftat energipolitiken till att handla mer om effektfrågan och att adressera och lyfta upp den, trots att vi under de kommande åren verkligen har en utmaning runt hörnet efter att Ringhals 1 och 2 har stängts. Det jag tror att vi kommer att prata mer om under den kommande mandatperioden är just svängmassan, som nu minskar väldigt snabbt i systemet när stora synkrongeneratorer försvinner ut. Vi kommer att ha ett otroligt känsligt system som inte kommer att möjliggöras av den väderberoende kraftproduktionen, och man har ingen plan för hur det ska hanteras.

Jag skulle vilja fråga på vilket sätt 100 procent förnybart per automatik leder till högre leveranssäkerhet, vilket regeringen motiverar sitt förslag med.

Anf.  25  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! Det blir tydliga skiljelinjer. Sammanfattningsvis kan man säga att Sverigedemokraterna är emot förnybar energi och för kärnkraft. Det får man gärna vara. Enligt den energiuppgörelse som finns och de mål vi nu fastställer ställer vi inte kraftslag mot varandra på det sättet.

Däremot är det bara att kolla hur verkligheten ser ut. Den nuvarande kärnkraften kommer att fasas ut av ekonomiska skäl – av ägarna. De säger att det med goda förutsättningar sker framemot 2040, och jag tror till och med att det kan gå snabbare just på grund av de ekonomiska skälen. Vad är då lösningen? Ja, vi argumenterar ju för att den tekniska revolution som just nu pågår och som skapar möjlighet att lösa många av de utmaningar och problem vi kan vara överens om finns är den väg vi bör ta.

Vad är då Sverigedemokraternas väg? Är det att bygga nya kärnkraftverk? Det finns ju en del grannländer som gör det. När det gäller att ersätta de tio nuvarande kärnkraftsreaktorerna med tio nya kan vi titta på våra finska grannar. Kostnaden för en reaktor som är ungefär lika stor – något större – än Oskarshamns tredje reaktor är ungefär 100 miljarder. Tio reaktorer innebär 1 000 miljarder kronor. Vem ska betala detta? Är det skattebetalarna som ska belastas med det? Enligt det nuvarande regelverket, som vi brett står bakom i riksdagen, ska det ske på privat grund. I ärlighetens namn är det ingen som tror på det.

Tror verkligen Sverigedemokraterna på att vi ska lösa dessa el- och energiproblem på ett effektivt och kostnadsmässigt bra sätt är den förnybara vägen den rimliga. Om Sverigedemokraterna inte står bakom detta måste de också redovisa var de ska ta 50 miljarder per år under 20 år för att bygga ny kärnkraft på skattebetalarnas bekostnad.

(Applåder)

Anf.  26  MARIA WEIMER (L) replik:

Herr talman! På ett energipolitiskt möte häromveckan fick Ibrahim Baylan frågan om han kunde sova gott på natten med tanke på energipolitikens utmaningar. Han svarade ja. Jag menar dock att det kanske ändå finns anledning att oroa sig lite för energipolitikens framtid om natten, och då tänker jag framför allt på leveranssäkerheten. Som några av oss nämnde i våra anföranden finns en rapport från Svenska kraftnät som visar på rätt oroande siffror. Att leveranssäkerheten riskerar att bli sämre än på 70-talet borde ändå leda till en och annan sömnlös timme.

Min fråga till energiministern är alltså: Är han inte orolig för hur vi ska lösa leveranssäkerheten, och hur tänker han sig att 100 procent förnybart bidrar till det målet?

Anf.  27  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! Tack för frågan, Maria Weimer! Det är en viktig fråga, men jag sover gott om nätterna just för att vi nu har en historisk och ny situation där en stor majoritet av Sveriges riksdag står bakom en gemensam energipolitik. Utmaningarna finns, men det är därför vi har en energiuppgörelse.

Det är därför vi tillsammans har lagt fram inte bara det här förslaget – den här mandatperioden har det ju regnat förslag baserat på energiuppgörelsen. Det har handlat om alltifrån förnybart till vattenkraft, om förutsättningarna för marknaden och om kärnkraften. Ja, herr talman, egentligen skulle jag nog säga att ända sedan de stora striderna om kärnkraften på 70-talet är den här mandatperioden kanske den mest intensiva när det gäller energipolitiken och dess förändring.

Det var på det seminarium där expertmyndigheten lade fram rapporten som jag fick frågan. Om man lyssnar på våra expertmyndigheter hör man att de säger: Ja, de två kärnkraftsreaktorer som är utfasade under den här mandatperioden och de två som planeras till 2020 klarar vi, för vi har sådana marginaler i vårt system. Men skulle all kärnkraft tas bort i ett snäpp får vi problem. Det är dock självklart, för kärnkraften står i dag för 40 procent av vår el. Det är därför vi har en energiuppgörelse som gör att vi steg för steg kan anta utmaningen.

Det finns utmaningar när det gäller leveranssäkerheten, men det finns också tekniska lösningar som vi nu implementerar. Vi lägger om vår vattenkraftspolitik så att den blir mer miljömässigt hållbar och så att vi kan få ut mer effekt av den. Vi har smarta nät, lagring och efterfrågeflexibilitet – många saker som vi nu tar oss an för att just se till att industrierna och våra hushåll alltid kan få fram den energi de behöver till konkurrenskraftiga priser.

Anf.  28  MARIA WEIMER (L) replik:

Herr talman! Jag menar att energiministerns politik delvis skjuter bredvid målet. En av de huvudframgångar för överenskommelsen som energiministern beskriver är nämligen 100 procent förnybart – ett mål vi inte behöver i dag.

Vi har inte problem med för lite väderberoende el; det var inte en utmaning vi utmålade när vi startade Energikommissionen. Vi har inte en utmaning med för lite vind eller sol i systemet, utan de utmaningar som var väldigt tydliga när vi startade arbetet var effektbalansen och leveranssäkerheten. Målet om 100 procent förnybart skjuter alltså helt och hållet bredvid de utmaningar vi egentligen har.

Vi vet att elnätet inför sommaren är så bräckligt att det inte skulle klara av att någon reaktor oplanerat kopplas bort. Vi vet att Svenska kraftnät har vidtagit den drastiska åtgärden att ge order om att dra ned på produktionen.

Herr talman! Jag menar att det finns anledning till oro. Inte ens sommaren är trygg när vi vet att vi vanligtvis på sommaren inte har kalla temperaturer och kan vara trygga. Det finns anledning till oro. Regeringens politik har delvis bidragit till det.

Anf.  29  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! Jag är den förste att beklaga att Liberalerna i likhet med i många andra politiska uppgörelser bara har hoppat av innan man ens har kommit fram till den slutgiltiga förhandlingen. Det som är Liberalernas problem i den här specifika frågan – energiuppgörelsen och energipolitiken – är att industrin, energisektorn, miljöorganisationerna och akademin alla har både välkomnat och stöttat energiöverenskommelsen.

Det gör de inte för att den är perfekt. Det vore förmätet att tro det. Det är för att vi nu skapar en stabil struktur där vi inte bara tar oss an de kortsiktiga utmaningar vi har utan steg för steg jobbar tillsammans för att lösa de långsiktiga. Det är en unik möjlighet både i Sverige och i svensk politik men också unik när man tittar runt om i Europa. Oavsett om det är i Tyskland, Finland, Storbritannien eller i Frankrike träter man fortfarande om detta, och det sker till väldigt höga kostnader.

Herr talman! Okej, Liberalerna är emot satsningarna på förnybar elproduktion, fine! Men vad är då Liberalernas lösning? När det gjordes en uppgörelse inom förra regeringen trodde Liberalerna att det skulle innebära tio nya kärnkraftsreaktorer där de gamla står på marknadsmässiga villkor. I dag är det väl bara Jan Björklund och tomten – och kanske inte ens tomten, utan bara Jan Björklund – som tror att det skulle hända. Ingen annan gör det. Vad är Liberalernas lösning?

Jag är den förste att beklaga att ni inte är med i uppgörelsen. Faktum är att vi har utmaningar. Vi kommer att sig an dem tillsammans. Men vad är Liberalernas väg framåt?

(Applåder)

Anf.  30  SOFIA FÖLSTER (M) replik:

Herr talman! Energiministern talar i sitt anförande om den historiska överenskommelse som vi har lagt fast. Den är historisk, viktig och bra. Det är vi helt överens om. Nu blir frågan hur vi når dit.

Hur når vi målen om energieffektivisering, minskade utsläpp, elektrifiering i transportsektorn och allt det som är helt nödvändigt för att vi ska kunna minska utsläppen och ha leveranstrygghet, konkurrenskraft och också en ekologiskt hållbar energiförsörjning?

Där lyfter jag fram perspektivet att det är helt nödvändigt att vi får ett företagsklimat i Sverige där vi får startup-företag som är de som levererar de nya lösningarna för att kunna gå fram med energilagring, energieffektivisering och alla de andra oerhört viktiga miljötekniker som vi behöver.

Det är helt nödvändigt. Vi kan med vår energiproduktion naturligtvis exportera till våra grannländer och de närmast oss. Men om vi ska få Kina, Indien och andra länder att ställa om måste vi också kunna exportera energiteknik.

Här ser jag en del utmaningar. Det är i form av regelkrångel som försvårar för företag och där företagare upplever att regelkrånglet har ökat den här mandatperioden. Här finns utmaningar i skattesystemet där det har blivit dyrare att anställa nyckelpersoner. Det har blivit svårare att rekrytera nyckelkompetens och nyckelingenjörer från andra länder.

Man kan också titta på frihandelsfrågan där det behövs ett ännu tydligare ställningstagande från båda regeringspartierna om vilka förutsättningar för frihandel man vill se.

Jag menar att det är helt nödvändigt och sammankopplat. Vi måste ha ett gott näringslivsklimat för att kunna nå målen och inte bara tala om målsättningarna. Här skulle jag vilja veta om ministern är nöjd med det näringslivsklimat vi har och om han tror att de nödvändiga startup-företagen kommer att starta i Sverige.

Anf.  31  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! Tack för frågan, Sofia Fölster. Jag håller med. Det är kanske lite ovanligt i dessa valtider att man håller med sina politiska motståndare, men så är det. Det arbete som vi nu gör skapar en miljö där nya innovationer och nya lösningar kommer fram.

Jag håller också med att det är lösningar som vi inte bara har användning för i vårt land med de utmaningar vi har utan som kanske i ännu högre grad kan vara grunden för en exportindustri som blommar och leder till fler jobb, ekonomisk tillväxt och samtidigt löser en del av de gigantiska klimatproblemen vi har.

Vi jobbar aktivt med detta. Det gäller att stötta startup-företag och hjälpa dem ut i världen. Jag tror att jag har haft ett femtiotal små och medelstora förtag med mig när jag har farit till Kina, Japan, Indonesien, Indien, Iran, Turkiet, Mexiko, USA med flera. Anledningen till att vi stöttar dem är att vi tror att vi har väldigt bra teknik, väldigt bra lösningar och väldigt duktiga entreprenörer.

Vad är det stora problemet? Jag är väldigt stolt över den näringslivspolitik vi bedriver. Det går väldigt bra för det svenska näringslivet. En av de stora utmaningarna är kompetensbristen. Där har vi satsat enormt mycket på att bygga ut vårt utbildningssystem. Det gäller såväl yrkeshögskola som högre utbildning, kommunal vuxenutbildning med mera för att se till att inte bara möta efterfrågan nu utan också framåt.

Herr talman! Man bör komma ihåg att en av huvudanledningarna till att vi sitter i en sådan situation är att det går väldigt bra för det svenska näringslivet. Vad gäller frihandel tror jag att vi är helt överens i varje fall mellan våra partier att det är väldigt bra. Här kommer inte hoten härifrån utan tyvärr från USA.

Anf.  32  SOFIA FÖLSTER (M) replik:

Herr talman! Det gläder mig att höra att energiministern i varje fall delvis håller med om det jag säger. Det gläder mig att vi delar intentionen i detta. Men sedan gäller det också att presentera skarpa reformer för att komma dit och nå de viktiga mål vi i dag fastställer.

Här ser vi att företagen upplever ett ökat regelkrångel under den här mandatperioden. De menar att det försvårar möjligheten att både starta företag och att växa. Det är ett problem som vi måste ta tag i. Det är helt nödvändigt om de startup-företag som utvecklar ny energiteknik också ska kunna exportera den.

Frihandelsfrågan är en annan viktig fråga. Där är visserligen våra två partier överens. Men Socialdemokraternas regeringspartner har inte ens bestämt sig. Där är inte alla överens i sin riksdagsgrupp om man vill ha frihandel med Kanada. Det är ändå ett land som har en mer progressiv energi- och miljöpolitik än till exempel Kina och många av de stora asiatiska utsläpparna.

Det finns ändå viktiga frågor att ta tag i även för regeringen för att kunna se till att vi får ett företagsklimat där nästa energiteknik skapas i Sverige.

Låt mig avsluta med att säga att vi ibland har en övertro på att det är vi i den här kammaren som ska lösa alla problem, att det är vi som kommer på alla nya uppfinningar och att det är vi som tar de stora klimatkliven. Det är inte det. Den som kommer på och utvecklar den elbil som blir så pass billig att den blir billigare för den indiska och kinesiska bilägaren att köpa än en bensinbil är den som tar det största klimatklivet.

Kan vi göra förändringar för att få ett näringslivsklimat som är gott inte bara i högkonjunktur utan också i lågkonjunktur kommer vi att ta de största klimatkliven. Ett stort medskick till regeringen är att ta vara på detta och att vara mer progressiv även vad gäller regelförenkling, frihandel och möjligheten för företagen att starta och växa här.

Anf.  33  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! När man är överens om den proposition som läggs fram vill män gärna ändå ha en debatt. Det är trots allt val, och man vill inte framstå som att man står alldeles för nära varandra. Det kan jag köpa. Jag ska ändå å mina vägnar göra något ovanligt genom att säga: Tack för ett väldigt gott samarbete! Det är trots allt det som i förlängningen kommer att spela en roll i detta.

Sedan till frågan om utrikeshandel och företagens villkor. Det skulle vara konstigt om företagen satte sig ned och sa att allting är fantastiskt. De driver på. Det är deras roll och deras uppgift, och det är bra. Men man får inte glömma hur verkligheten ser ut. Verkligheten är den att det nog inte finns någon regering som har satsat så mycket på exportfrämjande som denna. Det har också näringslivet självt uttryckt ett antal gånger. Det går väldigt bra för det svenska näringslivet. Det betyder inte att det inte finns problem och utmaningar. Jag är säker på att om vi precis som vi gjorde i energifrågan sätter oss ned tillsammans kan vi komma ett par steg framåt.

Herr talman! När det gäller frihandeln finns det i stora som små partier olika uppfattningar. Så är det också i Moderaterna. Det märker man dagligdags. Regeringen tror på frihandel och föreslår riksdagen att vi ställer oss bakom detta CETA-avtal eftersom det är bra för vårt land. Det är också bra för vår värld med denna typ av kontakter, dialog och verksamhet.

Nu är vi tyvärr i en sits där utvecklingen just nu går åt fel håll. Därför är det viktigt att inte hålla på och göra en träta av något som inte är en träta. I stället bör vi gemensamt och med full kraft, både i Europeiska unionen och med våra partner på andra sidan Atlanten, föra fram att den väg man har valt inte är bra vare sig för de amerikanska konsumenterna och de amerikanska industrierna eller för någon annan på globen. Jag tror att detta är viktigare än att vi håller på och träter om något som i grund och botten inte är någon träta.

Anf.  34  RICKARD NORDIN (C) replik:

Herr talman! Jag blir sist ut här i kammaren, vilket känns lite speciellt, under den här mandatperioden. Jag vill därför börja med att tacka Ibrahim Baylan och regeringen. Vi har haft många debatter och tuffa debatter. Vi har haft förhandlingar som stundtals har varit hårda men som i slutändan har varit konstruktiva. De har inte minst – efter vissa påtryckningar, får man väl säga – innehållit väldigt bra fika.

Det finns ändå en del saker som kan göra mig lite bekymrad och som jag funderar på hur regeringen ser på. Jag frågade tidigare om ursprungsgarantierna för el. Vi har ett liknande system när det kommer till biogasen – grön-gas-principen. Om ett bolag levererar 100 procent biogas och levererar in det på nätet kan jag alltså som konsument köpa 100 procent biogas. Det är på samma sätt som när Energimyndigheten säger att man ska kunna leverera in det och därmed också sälja det.

Tycker regeringen att detta är en bra princip? Och tycker regeringen att detta är en laglig princip? Det är mina frågor till statsrådet.

Anf.  35  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! Låt mig börja med en annan fråga, som Rickard Nordin ställde tidigare till socialdemokraten Patrik Engström och som Patrik Engström hänvisade till mig, nämligen den om Boverkets byggregler. Jag vill ju att Rickard Nordin ska få svar på sina frågor.

Jag tror att vi är unisont överens i denna kammare och även i energiuppgörelsen om att systemet behöver läggas om. Det är inte bra som det är i dag, då det leder oss bort från ett effektivare och mer klimatvänligt system. Fjärrvärmen matas ju med näst intill 100 procent, åtminstone 95 procent, förnybar energi.

Vi kommer att fortsätta att jobba med frågan, men vi förfogar inte över den själva. Det är också EU-direktiv som reglerar detta, och det är det som har gjort att vi inte har kunnat komma fram. Vi måste fortsätta att bearbeta EU så att man kan ändra på dessa direktiv.

Det som komplicerar saken är att det finns väldigt få europeiska länder som har fjärrvärme. Däremot satsas det brett på solceller och annat just nu. Men vi ska återkomma till detta under nästa mandatperiod. Vi har inte släppt det, och vi ska se till att vi får till den förändring vi behöver för att få detta här i Sverige.

Herr talman! När det gäller ursprungsgarantier är det ganska talande för hur energipolitiken har utvecklats i vårt land när en debatt och ett replikskifte ska handla om just detta. Men det är viktiga frågor. Och nej, vi har inte hittills från regeringens sida uppfattat problemet. Nu dyker det upp, och då får vi titta på det och se om det behöver göras förändringar i lagar och förordningar. I så fall kan vi göra det.

Det är precis som Lise Nordin sa tidigare: Ibland blir man som minister anklagad för att man inte agerar mer kraftfull, men när man gör det anklagas man för ministerstyre. Och ministerstyre vill man inte ägna sig åt i onödan, eller hur?

Anf.  36  RICKARD NORDIN (C) replik:

Herr talman! Nu var det grön-gas-principen jag frågade om. Ibrahim Baylan använde en minut och tio sekunder till att tala om Boverkets byggregler, och sedan talade han om ursprungsgarantier. Det handlar ju om el och inte alls om biogas.

Jag tycker att det är lite fascinerande, och det verkar som att regeringen väljer att inte svara över huvud taget. Vi kan väl se fram emot nästa mandatperiod när regeringen tar tag i det här och vi har ombytta roller. Då kan vi stå omvänt här i talarstolarna och debattera detta.

Före energiöverenskommelsen förhandlade vi om en förordning om effektreserven. Effektreserven ska utgöras av anläggningar som använder förnybar energi – en grön effektreserv. Men när det kom in anbud till denna effektreserv med 100 procent biogas sa Svenska kraftnät: Inköp och annullering av biogascertifikat förändrar inte det faktum att anläggningen vid en aktivering av effektreserven skulle drivas med fossilt bränsle, för det är det som levereras i näten.

Då har man totalt missuppfattat hela grön-gas-principen. Detta skedde under den förra upphandlingen. Tycker regeringen att detta är ett problem? Centerpartiet tycker att det är ett problem att Svenska kraftnät gör så här. Svenska kraftnät står under regeringens tillsyn, vilken går att använda i regleringsbrev och annat utan att man som minister själv uttalar sig. Regeringen som helhet kan styra, och bör styra, sina myndigheter.

Detta kraftverk hotas nu av nedläggning; man ansöker om nedläggning just nu därför att man inte fick upphandlingen. I stället är det fossil olja som utgör kraftreserven.

Mina frågor återstår därför, Ibrahim Baylan: Accepterar regeringen grön-gas-principen? Och vad tänker man i så fall göra för att de egna statliga affärsverken, i det här fallet, också ska acceptera den?

Anf.  37  Statsrådet IBRAHIM BAYLAN (S) replik:

Herr talman! Jag trodde naivt nog att Rickard Nordin var intresserad av att få svar på sina frågor – därav det faktum att jag använde en minut till att svara på hans första fråga.

Men det är som sagt valtider, och när man står så nära varandra och röstar för samma politik men ändå känner ett behov av att visa att man minsann är i opposition kan man såklart alltid försöka få till trätor i frågor där det inte finns några trätor.

I frågan om upphandlingen för Svenska kraftnät är detta reglerat såväl i lag som i förordning. Det vet Rickard Nordin. Utöver att vi vill att det ska vara mer förnybart måste det också vara ekonomiskt gångbart. Inte minst denna riksdag har sett till att det är på det sättet. Det är de två principer som gäller.

Man ska inte heller överdriva vad detta handlar om. Den reserv som vi har och som vi har förlängt används knappt. Vi har den eftersom den är en reserv för trygghet, men de facto används den så oerhört sällan som tre fyra gånger, tror jag, på ett decennium. Vi ska inte överdriva dess påverkan på vårt klimat eller på vårt energisystem.

Låt mig ta ett exempel. Den 28 februari i år hade vi årets kallaste dag. Mellan klockan åtta och nio på morgonen var vi uppe i ett behov av elproduktion på ca 26 750 megawatt. Då var reserven igång, men den användes aldrig. Man ska alltså inte överdriva.

Ja, vi vill ha mer förnybar energi också i effektreserven. Ja, det är upp till Svenska kraftnät att upphandla detta. Då gäller principen att det ska vara både grönt och ekonomiskt konkurrenskraftigt och därmed också billigast möjligt för konsumenterna när reserven används.

(Applåder)

 

Överläggningen var härmed avslutad.

(Beslut skulle fattas den 19 juni.)

§ 6  Elmarknadsfrågor

 

Näringsutskottets betänkande 2017/18:NU23

Elmarknadsfrågor (prop. 2017/18:237)

föredrogs.

 

Talmannen konstaterade att ingen talare var anmäld.

(Beslut skulle fattas den 19 juni.)

§ 7  Solidaritet vid kris i naturgasförsörjningen

 

Näringsutskottets betänkande 2017/18:NU27

Solidaritet vid kris i naturgasförsörjningen (prop. 2017/18:251)

föredrogs.

 

Talmannen konstaterade att ingen talare var anmäld.

(Beslut skulle fattas den 19 juni.)

§ 8  Politiken för global utveckling (PGU)

 

Utrikesutskottets betänkande 2017/18:UU21

Politiken för global utveckling (PGU) (skr. 2017/18:146)

föredrogs.

Anf.  38  SOFIA ARKELSTEN (M):

Herr talman! Jag börjar med att yrka bifall till reservation 1 om politikens huvuddrag och genomförande. Det är en bra reservation.

I dag debatterar vi politiken för global utveckling med anledning av en skrivelse från regeringen. PGU, som det förkortas, är ett sätt att se till att politiken håller ihop. Det är ett sätt för riksdagen att uppdra åt regeringen att hålla ihop det som sägs med det som görs. Resultatet ska vi få i skrivelsen.

Nu blev det inte så bra i form. Skrivelsen är anekdotisk och går inte att följa upp, och ansvarigt statsråd är som vanligt inte med i debatten.

Skrivelsen buntar också ihop PGU med FN:s globala hållbarhetsmål. Det är ett sätt för regeringen att flytta makt över frågorna från riksdagen till regeringen. Det uppskattar vi inte. Ha respekt för riksdagens beslut! Sluta med de här glidningarna!

Särskilt märkligt blir det eftersom nuvarande regering i går fattade beslut om en nationell handlingsplan för hållbarhetsmålen. Den kan vi inte diskutera här i dag eftersom regeringen har gjort för lite och för sent. De utlovade en stark parlamentarisk förankring, men det blev inget av den. Den lämnades inte som en skrivelse till riksdagen för debatt och beslut, utan den är en ren regeringsprodukt som bara gäller för S och MP. Precis som den nuvarande regeringen har den också ett bästföredatum som är den 9 september.

Det är olyckligt – både politiskt och för att mycket tid och kraft har gått in i den planen. Men den politiska ledningen har inte levererat. Den har varken samarbetat eller förankrat. Vi hade kanske kunnat säga mer om planen i dag i debatten, men nej, den publicerades bara en kort stund i går på regeringen.se. Men nu har statssekreteraren ringt och lovat mig att den kommer att läggas upp så snart den har expedierats – möjligen är det när vi är klara här.

Herr talman! PGU har länge haft brett politiskt stöd. Jag förutsätter att den politik Sverige för bidrar till att uppfylla hållbarhetsmålen som vi har förbundit oss till. Det finns naturligtvis politiska skillnader och olika politiska prioriteringar. Vi lyfter särskilt handelns roll för utveckling till exempel. Men när regeringen redovisar arbetet så här slafsigt blir det svårt att följa upp. Det är hela utskottet överens om, även om ordvalet möjligen är ett annat.

Herr talman! Det kanske är dags att diskutera PGU på riktigt. När det infördes var det någonting nytt, men med hållbarhetsmålen och hela den nya och globala strukturen att arbeta inom kanske PGU har spelat ut sin roll. Oavsett om det är så eller inte är det riksdagens beslut, inte regeringens. Och vi drar inte ur pluggen på PGU i en liten skrivelse. Nej, regeringen måste säkerställa att arbetet med både PGU och hållbarhetsmålen förankras parlamentariskt. Det finns en stor samsyn och mycket som vi är överens om, och det är bra för Sverige.

Sverige ska leverera på hållbarhetsmålen. Det är det minsta vi kan förvänta oss. Vi är på god väg tack vare flera breda och bra beslut i riksdagen.

Anf.  39  JULIA KRONLID (SD):

Herr talman! Som tidigare har sagts debatterar vi i dag utrikesutskottets betänkande 21, Politiken för global utveckling (PGU). Jag vill börja med att yrka bifall till Sverigedemokraternas reservation nr 2.

Som framgår i skrivelsen från regeringen som vi behandlar här antog FN:s generalförsamling i september 2015 Agenda 2030 och de globala målen för hållbar utveckling. Ledare från världens alla hörn enades om att målen ska bidra till en socialt, ekonomiskt och miljömässigt hållbar utveckling och vara uppnådda senast 2030 i världens alla länder. Agenda 2030 ersatte den 1 januari 2016 de åtta milleniemål som FN och världens länder hade arbetat med sedan 2000.

De 17 målen är indelade i 169 delmål. Jag hade förmånen att befinna mig i New York och FN ganska snart efter att målen hade antagits. Jag tyckte att det var högtidligt, och det var intressant och givande att få höra olika seminarier och diskussioner rörande hur världens länder kunde enas om de här målen.

På papperet som jag nu håller upp visas den färgglada, fina bilden som beskriver målen och som många säkert har sett. Man kan köpa olika pins och så med den på. Jag tycker att det här är någonting positivt som FN har genomfört. Andra saker som FN har genomfört har kanske inte alltid varit så positiva, men det här är någonting bra.

Utskottet framför i betänkandet att politiken för global utveckling har som mål att utgå från fattiga människors perspektiv på utveckling, vilket innebär att det är deras behov, intressen och förutsättningar som ska vara utgångspunkten i arbetet med att uppnå en rättvis och hållbar global utveckling. Rättighetsperspektivet innebär att de mänskliga rättigheterna, demokrati och rättsstatens principer ska ses som grundläggande för utveckling.

Att det här är någonting bra är vi väl alla överens om i utskottet. Sedan har vi viss kritik mot hur regeringen har redovisat det här och hur man har genomfört det. Jag kommer in lite mer på det sedan.

När det gäller Sverigedemokraternas syn på de här målen tycker vi att just att utgå från fattiga människors perspektiv på utveckling är av stor vikt inom det internationella utvecklingssamarbetet. Vår övergripande målformulering för biståndet är att verka för en biståndspolitik som skapar förutsättningar för människor i fattigdom och förtryck att förbättra sina levnadsvillkor utifrån grundläggande behov i den omedelbara vardagen. Fokus bör ligga på fattigdomsbekämpning och att barnens bästa ska få stå i centrum.

Det är bra att det fortfarande finns ett mål nr 1 som handlar om att utrota fattigdomen. För att uppnå detta menar vi att ett större fokus inom biståndspolitiken borde ligga på att rikta sig till de mest utsatta människorna i de minst utvecklade länderna.

Herr talman! Ett annat mål som jag har lyft fram flera gånger i processen när vi har diskuterat de här målen är mål nr 6 om rent vatten och sanitet, vilket är en förutsättning för flera andra mål, såsom hälsa och välbefinnande i mål 3 och jämställdhet i mål 5. Brist på vatten och sanitet drabbar kvinnor och barn extra hårt och hindrar deras möjligheter till utveckling. Upprepade diarréer är den näst vanligaste dödsorsaken bland små barn i fattiga länder. Därför menar vi att regeringen borde göra mycket mer när det gäller satsningar inom biståndet för att verka för att de här målen uppnås.

Förorenat vatten och brist på tillgång till sanitet utgör också en hälsorisk för gravida och vid förlossning. Bristen på rent vatten kan förhindra kvinnors möjligheter till jämställdhet – den förhindrar kvinnors möjligheter till deltagande i samhället.

Sammanfattningsvis är tillgång till rent vatten, säker sanitet och hygien grundläggande mänskliga rättigheter och avgörande för människors överlevnad, hälsa, jämställdhet, utbildning, välfärd och ekonomiska produktivitet.

Herr talman! När det gäller målet att utrota fattigdom och målet om anständiga arbetsvillkor och ekonomisk tillväxt anser vi att det är viktigt med insatser som bidrar till ökad sysselsättning och ekonomisk utveckling. Det är avgörande för en framgångsrik fattigdomsbekämpning. Vi ser positivt på en ökad samverkan med näringslivet och privata aktörer för jobbskapande insatser. Givetvis är det också väldigt viktigt med satsningar på handel.

När det gäller de mål som berör en miljömässigt hållbar utveckling lyfter vi i vår valplattform fram att vi på ett ännu tydligare sätt genom biståndet vill satsa på bevarandet av viktiga regnskogar. Tropikskogens naturresurser är viktiga för djurlivet, och skogen är också en ekonomisk resurs i form av timmer. Den har också en väldigt viktig klimatfunktion. När omfattande skogsarealer huggs ned förändras det lokala och regionala klimatet på många olika sätt. Det här är en viktig fråga som jag tycker glöms bort alldeles för mycket i miljö- och klimatdebatten.

Skillnaden mellan de här målen och de tidigare millenniemålen är att Agenda 2030 inte bara riktar in sig på hur vi ska hjälpa och bidra till utvecklingsländerna och att utvecklingsländerna själva ska bidra till utveckling, utan det handlar också om hur Sverige på ett nationellt plan ska kunna uppnå de här målen.

Regeringen har arbetat med att ta fram en handlingsplan för genomförandet av Agenda 2030. Som en del i detta tillsatte regeringen i mars 2016 en delegation med uppgift att stödja och stimulera arbetet. Agenda 2030-delegationen lade fram en delrapport 2017 med förslag till handlingsplanen och ska slutredovisa sitt arbete 2019.

De här sakerna är väl bra, men vi anser att det här inte räcker. Dels måste dialogen med riksdagen bli mycket bättre, dels, som vi framhåller i vår reservation, vill vi för att på ett ännu mer oberoende sätt utvärdera Sveriges arbete med Agenda 2030 se en återkommande utvärdering av en extern, internationell part som kan bedöma hur Sverige uppfyller målen i Agenda 2030 utöver de rapporter som redan i dag lämnas till FN.

Detta är mitt sista anförande under den här mandatperioden, och jag vill tacka för den här tiden och önska alla en riktigt glad och trevlig sommar. Vi ses i valrörelsen!

 

I detta anförande instämde Heidi Karlsson (SD).

Anf.  40  KERSTIN LUNDGREN (C):

Herr talman! Den här PGU-skrivelsen, som jag nu visar för kammarens ledamöter, är den andra under den här mandatperioden, och den kom i mars. I skrivelsen redovisar regeringen ”exempel på sitt arbete med politiken för global utveckling (PGU) under åren 2016 – 2017 inom ramen för Agenda 2030 och de globala målen”. Riksdagen har alltså fått ännu en exempelsamling från regeringen att behandla.

För 15 år sedan, 2003, beslutade den här kammaren om politik för global utveckling. Det var ett parlamentariskt väl förberett beslut. Det var viktigt för att få långsiktighet i utvecklingsarbetet, över mandatperioder och över regeringar. De fastlagda målen innebär att man ska utgå från ”fattiga människors perspektiv på utveckling” och, som vi har markerat, ha ett tydligt rättighetsperspektiv utifrån grundläggande rättigheter som mänskliga rättigheter, demokrati och rättsstatens principer.

Det var en god ambition. Och det är en god ambition att den här regeringen, precis som tidigare regeringar, har försökt samla ihop sig för att få en samsyn och få med hela regeringen i arbetet när det gäller politik för global utveckling.

Herr talman! Goda ambitioner kan vara vällovliga, men de måste kunna följas upp. I samband med att millenniemålen ersattes av Agenda 2030, de 17 målen och alla delmål därunder valde regeringen att samla ihop allt och tappade fokus. Man tappade målbilden.

Vi var några som inför behandlingen av förra skrivelsen tittade på de handlingsplaner som regeringen hade. De var hemliga för den här kammaren. Men jag kan avslöja att de inte var speciellt intressanta. Det var snarare tur att kammaren inte belastades med dessa exempelsamlingar. Och på den vägen har det fortsatt. Nu får vi en skrivelse igen.

Vi har en granskande roll; det är en del av utskottets och kammarens uppdrag att granska om regeringen når upp till de mål som man har lagt fast. Men där går utskottet bet, herr talman. Vi har haft en bild av att regeringen har haft breda konsultationer om Agenda 2030. Man tillsatte delegationen. Men man har inte förankrat parlamentariskt, till skillnad från på andra områden. Vi har haft miljömålsberedningar. Vi har antagit lagstiftningar. Vi har tydliga mål med vad vi vill uppnå. Och regeringen får arbeta utifrån riksdagens fastlagda ställningstaganden om fastlagda mål. Men på det här området finns inga tydligt fastlagda mål av riksdagen.

Vi noterar att den av regeringen tillsatta delegationen i sin slutrapport också har insett att riksdagen inte har konsulterats och involverats. Den ger en tydlig rekommendation om vikten av att ha en bred politisk förankring, företrädesvis till och med blocköverskridande överenskommelser – hör på det, herr talman – och långsiktiga mål. Gemensamma strategier är sådant som det är möjligt för den här kammaren att följa upp. Och det är sådant som är möjligt också för utskotten att följa upp.

I utrikesutskottet var vi eniga om att det var viktigt att ge hela riksdagens utskottsorganisation möjlighet att säga sitt om regeringens andra skrivelse med anledning av PGU och Agenda 2030. Men precis som framgår av betänkandet har inte ett enda utskott valt att yttra sig över skrivelsen. Det säger något om arbetet med Agenda 2030 och PGU i riksdagen under den här mandatperioden.

Det är naturligtvis inget som är bra. Men om man lägger upp arbetet som en exempelsamling är det inte möjligt för riksdagens utskott att arbeta aktivt med detta, att vara granskande och följa upp. Det finns inte heller något tydligt att lägga fast som mål.

Herr talman! Därför är en parlamentarisk beredningsprocess nödvändig, som vi ser det, i likhet med PGU-arbetet. Vi vill utveckla och uppgradera målen när det gäller PGU. Och vi vill göra det kopplat till Agenda 2030. Det har vi gjort tydligt i vår reservation i betänkandet. Jag yrkar bifall till reservation 3 under punkt 1.

Vi lyfter också fram en annan reservation om att bekämpa klimatförändringarna. Men för tids vinnande yrkar jag inte bifall till den, även om jag självklart står bakom den. Klimatförändringarna påverkar oss alla, hela tiden men på olika sätt. Klimatinvesteringar för anpassning och klimatinvesteringar för åtgärder måste till.

Vi ser att människor på landsbygden, oftast kvinnor, drabbas hårdast av klimatförändringarna och bristen på åtgärder. De har många gånger uppdraget att säkra mat, vatten och energiförsörjning. Och de drabbas hårt av bristerna på det här området. De drabbas också hårt av torka och naturkatastrofer.

I Centerpartiet är vi beredda att satsa för att hitta både investeringar som är klimatsmarta och åtgärder som blir hållbara. Det är vi beredda att göra genom att tillföra mer resurser till den gröna fonden. Vi har under den här mandatperioden visat att vi har varit beredda att tillföra ytterligare resurser, även bortom biståndsbudgeten, på 1 procent av bni. Vi har också en ambition att försöka arbeta för att hitta nya sätt att säkra de finansiella resurser som man globalt har kommit överens behöver tillföras den gröna fonden för att vi ska kunna nå klimatmålen i Parisavtalet.

Herr talman! Med det yrkar jag bifall till reservation 3 under punkt 1.

Anf.  41  YASMINE POSIO NILSSON (V):

Herr talman! Nu debatterar vi utrikesutskottets betänkande om regeringens skrivelse Politiken för global utveckling i genomförandet av Agenda 2030.

Vänsterpartiet har tidigare påpekat att millenniemålen fick för litet utrymme i den förra regeringens utvecklingspolitik. Alltför mycket av den svenska utvecklingspolitiken saknade dessvärre under denna tid en tydlig koppling till målen. Att den rödgröna regeringen valde att tydligt knyta an till Agenda 2030 i uppdateringen av PGU var därför mycket välkommet.

Utvecklingspolitiken präglas dock fortfarande av en oförmåga att tydligt låta utvecklingsmålen styra och få företräde framför andra politiska områden.

Jag vill passa på att påpeka att det finns skillnader mellan politik för global utveckling och Agenda 2030 och att PGU inte enbart ska ses som ett verktyg för att uppnå målen med Agenda 2030.

Även om vi som länder ska stötta varandra i att uppnå målen i Agenda 2030 är det upp till varje land att arbeta för att de ska bli verklighet på hemmaplan.

Självklart ska till exempel mål 4 om en god utbildning för alla vara ett mål i vår utvecklings- och biståndspolitik, men även utbildningsutskottet måste arbeta för att alla barn i Sverige får en god utbildning och inte bara vissa.

Politik för global utveckling är inte och bör inte heller enbart ses som ett verktyg för att uppnå Agenda 2030, så som det beskrivs i skrivelsen. Däremot ska och bör PGU genomsyra politiken inte bara i utrikesutskottet utan även inom andra områden som berör utvecklingen i andra länder. Målkonflikterna ska väga tyngre när det gäller Agenda 2030:s mål.

Regeringen slår sig ofta för bröstet när det gäller den feministiska utrikespolitiken, och visst har de gjort en hel del bra saker. Jag kan inte nog understryka hur viktigt det var att Sverige vägrade följa Trumps gag rule som innebär allvarliga inskränkningar i flickors och kvinnors liv och hälsa. Tvärtom ställde sig Sverige upp och sa att vi inte sviker flickors och kvinnors rätt att själva bestämma över sina kroppar.

Samtidigt har Sverige fortsatt att exportera vapen till länder som är auktoritära, odemokratiska och kränker mänskliga rättigheter.

Herr talman! Bistånds- och utvecklingsplattformen Concord skriver i sin rapport om den feministiska utrikespolitiken 2017 att en ökad spridning av vapen bidrar till ökad militarisering och utgör ett direkt hot mot kvinnors säkerhet.

Man konstaterar att ”om den feministiska utrikespolitiken och Sveriges Politik för Global Utveckling ska vara trovärdig kan Sverige inte genom krigsmaterielexport understödja stater som systematiskt motverkar de värden och målsättningar som den feministiska utrikespolitiken står för”.

Rapporten riktar även skarp kritik mot migrationspolitiken, där man pekar på hur den tillfälliga lagen kritiserats av flera tunga remissinstanser. Lagen innebär att familjer splittras, helt i strid med barnkonventionen och Europakonventionen om mänskliga rättigheter.

Den slår också särskilt hårt mot kvinnor, barn och äldre som blir kvar i misären i flyktingläger eller på internflykt i krigshärjade länder utan möjlighet till lagliga vägar för att kunna söka asyl och få sin sak prövad här i Sverige. I rapporten skriver man: ”Många av de flickor och kvinnor som blir kvar i flyktinglägren och i närområdena tvingas in i äktenskap som en lösning på en desperat situation, och de som ger sig ut på flykt löper stor risk att utsättas för sexuellt våld och trafficking.”

Visst gör Sverige bra saker när det gäller den globala utvecklingspolitiken och för att uppnå målen med Agenda 2030, men vi kan inte blunda för det som inte görs eller för det som står i direkt motsättning till en feministisk utrikespolitik.

Det finns målkonflikter där den globala utvecklingspolitiken och uppfyllandet av målen med Agenda 2030 tydligen väger lätt för regeringen i förhållande till annat, såsom att tjäna pengar eller att stoppa människor på flykt.

Det andra jag vill lyfta fram i vår reservation är den privata sektorns roll i utvecklingssamarbetet, någonting som den förra, borgerliga regeringen arbetade ihärdigt för att stärka. Vänsterpartiet ifrågasatte då den prioriteringen, delvis på grund av bristerna i uppföljning och redovisning avseende privatsektorbiståndet.

Precis som biståndsorganisationernas arbete ständigt är under uppföljning och noggrant utvärderas måste de privata aktörerna avkrävas ansvar för sitt arbete. Naturligtvis borde de biståndsmedel som går till företag eller näringslivsorganisationer följas upp och utvärderas precis på samma sätt som annat bistånd.

Därmed, herr talman, yrkar jag bifall till reservation 4.

En förutsättning för mänsklighetens framtid är att vi över huvud taget har en miljö som går att leva i. Naturen behöver ett mycket starkare rättsligt skydd.

Redan 1971 motionerade Vänsterpartiet i riksdagen om en internationell konvention för att förbjuda ekocid, det vill säga brott mot naturen. Behovet av att skydda miljön rättsligt har ökat med åren. Fallen av storskaliga ingrepp på miljön som skadat ekosystem och livsmiljöer för oöverskådlig tid är tyvärr många, och dessvärre kommer miljöbovarna lätt undan.

Glädjande nog har ICC meddelat att domstolen nu ska börja ta sig an vissa miljömål. Det är ett viktigt steg framåt. Men ännu bättre vore en renodlad ekocidtillämpning, där alla fall med omfattande miljöförstöring skulle vara åtalbara. Sverige bör ta initiativ och driva på inom FN och EU för att uppdatera det juridiska ramverket så att det blir ett kraftfullt verktyg för att förhindra ekocid genom att inkludera det i Romstadgan. Då skulle vi verkligen arbeta med Agenda 2030.

Avslutningsvis vill jag säga att intentionerna med PGU och Agenda 2030 är riktigt bra. På vissa områden fungerar det arbetet också bra, både när det gäller att uppmuntra arbetet och när det gäller handlingsplaner. Det vi saknar är tydliga utvärderingar och större samverkan med riksdagen. Vi vill även se fler analyser av de målkonflikter som faktiskt finns.

Nu gäller det för regeringen att se till att PGU och Agenda 2030 på riktigt genomsyrar alla områden och får den tyngd som behövs för att politiken ska bli trovärdig.

Anf.  42  PENILLA GUNTHER (KD):

Herr talman! Naturligtvis är det bra att Sverige var tidigt ute med att ha en politik för global utveckling. Det kan vi inte säga någonting om. Agenda 2030 och de nya hållbarhetsmålen skulle möjligen kunna ses som att världen i övrigt har kommit i kapp Sverige.

Dessvärre är det nog så att om inte Agenda 2030 och PGU förstärker och kompletterar varandra så blir inte PGU den förutsättning som vi tycker att det ska vara utan snarare ett verktyg för just genomförandet av Agenda 2030. Politik för global utveckling handlar ju om så mycket mer än bistånd. Det kanske är någonting som inte alla riktigt har greppat, och troligtvis inte regeringen, för då hade man agerat på ett helt annat sätt.

Riksdagen måste ha en betydande roll i arbetet med PGU och genomförandet av Agenda 2030 om vi ska vara trovärdiga. Politiken i sig ska sträva efter att vara långsiktig inom alla områden, och då är det inte tillräckligt att regeringen bjuder in till något slags allmänt seminarium om de här frågorna eller möjligtvis kommer till olika utskott och informerar.

Herr talman! Det måste vara en delaktighet som är värd namnet. Jag som vanligtvis sitter i näringsutskottet och debatterar den typen av frågor tycker att det här verkligen är någonting som även vi från den sidan borde ha varit delaktiga i.

Jag håller ett kort i handen som tydligt visar att industrin tar Agenda 2030 på allvar. Jag har kortet i handväskan för att påminna mig själv när jag inte kommer ihåg de olika 17 målen. I olika branscher har man redan tagit initiativ på olika områden, även det någonting som verkar ha gått regeringen förbi. Man har tillsatt fler personer i gruppen som ska jobba med Agenda 2030, men vad betyder det om man ändå inte förankrar det i riksdagen och på alla olika politikområdena som det handlar om?

Concord Sverige har nyligen gjort en kartläggning av detta med Agenda 2030 och partiernas inställning. Där visar man tydligt att det finns olika synsätt på hur det här ska förverkligas. Varför tar man då inte tillfället i akt att samla partierna och gå igenom hur man vill göra med Agenda 2030, så att det blir så varaktigt som möjligt? Själva idén är mål för en hållbar utveckling. Då måste vi också kunna omsätta detta till inte minst nationell politik.

När det handlar om den nyligen beslutade handlingsplanen, som kom i går, kunde jag läsa mig till att man har valt sex tvärsektoriella områden: jämlikhet och jämställdhet, ett hållbart samhälle, en samhällsnyttig, cirkulär och biobaserad ekonomi, ett starkt näringsliv med hållbart företagande, en hållbar och hälsosam livsmedelskedja samt kunskap och innovation. Visst kan jag putta in de 17 olika målen i de här tvärsektoriella områdena – absolut! Men jag kan jämföra med den föregående debatten om energipolitikens inriktning. Där pratade vi ju om det här med ett fossilfritt Sverige. Branscherna har själva formulerat färdplaner för att uppnå detta utifrån sina respektive förutsättningar. Det kan väl tänkas att man skulle ha kunnat jobba på samma sätt även när det gäller de här frågorna.

Här ger man uppdrag till myndigheter. Naturligtvis är det bra att man tycker att Ekonomistyrningsverket, SCB, Statskontoret och så vidare följer upp och redovisar detta. Vi kristdemokrater har också saknat någon form av modell för uppföljning. Det som vi reagerar på är att man vill tillsätta en ny utredning för att få fram fler idéburna offentliga partnerskap, så kallade IOP. Då blir jag väldigt förvånad, för jag satt själv i referensgruppen till en utredning som kom för snart två år sedan, nämligen Palett för ett stärkt civilsamhälle, där man pratar precis om det här. Det är utrett väldigt grundligt på längden och tvären, skulle jag vilja påstå. Men man har inte tagit till vara de här förslagen över huvud taget.

Herr talman! Jag skulle vilja säga att detta är signifikativt för den här regeringen. Man utreder saker, låter folk tala och vara med och så vidare. Men sedan bryr man sig inte alls om vad utredningen har kommit fram till. Man agerar ändå på eget sätt och på eget bevåg och kan inte ta till sig och ta vara på det som kommer fram. Jag vet inte vad det är för kriterier man har när man tillsätter utredningar.

Jag tror att många har känt sig lurade under den här mandatperioden. De har fått vara med i referensgrupper och säga sin mening, men sedan är det ändå ingen som bryr sig. Det här visar på detta med all tydlighet. När det finns en färdig utredning med goda förslag som i stort sett hela civilsamhället har ställt sig bakom vill man ändå tillsätta en ny. Jag tycker verkligen att det är slöseri med pengar. Vi pratar om global utveckling, om att utrota fattigdom, om att vi ska ha en hållbar cirkulär ekonomi och så vidare. Här kan vi verkligen prata om cirkulär ekonomi, när de flesta utredningar verkar hamna i det cirkulära arkivet, som man brukar säga.

Herr talman! Jag yrkar bifall till Kristdemokraternas reservation nr 5 under punkt 1. Den rör det jag har talat om här i dag: regeringens ansvar för att säkerställa att genomförandet av Agenda 2030 och PGU får en bred parlamentarisk förankring, offentliggörande av departementens handlingsplaner samt vikten av att en kontinuerlig extern granskning av regeringens arbete görs för att uppnå samstämmighet, så att vi når de här målen gemensamt framöver.

Anf.  43  MARIA ANDERSSON WILLNER (S):

Herr talman! Jag yrkar bifall till förslaget i betänkandet.

I dag debatterar vi politik för global utveckling. Det handlar om samstämmighet i politiken, både mellan politikområden och mellan utformningen av politiken och genomförandet och uppföljningen av densamma. Det handlar om komplexa samband och om att orka och kunna se världen som en helhet. Den här samstämmiga politiken syftar ytterst till en hållbar, fredlig och rättvis utveckling.

Under den här mandatperioden har regeringen gjort en nystart av PGU-arbetet. Nystarten skedde i linje med de svenska civilsamhällesorganisationernas rekommendationer. Regeringens arbete för att göra PGU till hela regeringens politik har varit framgångsrikt. Vi har tydligt orkat och lyckats koppla den till arbetet med Agenda 2030, och det har tagits emot positivt. Det finns en ökad öppenhet och vilja till dialog från regeringens sida vad gäller att ta in synpunkter från civilsamhället och akademin. De organisatoriska förutsättningarna för att genomföra PGU har också förbättrats. Vi har blivit ännu bättre på att ta till vara synergier mellan olika politikområden. Trots det finns det självklart kvarstående intresse- och målkonflikter, som också redovisas av regeringen.

Redan 2003 gav PGU Sverige ett viktigt redskap för att förverkliga ambitionen om en samstämmig politik. Den är ett centralt bidrag till att kunna uppfylla de nya globala målen. Jag skulle särskilt vilja lyfta fram regeringens arbete med mål 5 i Agenda 2030, jämställdhetsmålet. Där spänner samstämmighetspolitiken över såväl sexuell och reproduktiv hälsa, med rätt till barnmorska och rätt och tillgång till preventivmedel och säkra aborter, som kvinnors och flickors skydd mot människohandel, tillgång till anständigt och produktivt arbete för kvinnor och stärkt äganderätt för kvinnor.

Regeringens arbete fortsätter. Det finns saker att göra när det gäller förankringen i riksdagen. Ett enigt utskott står bakom att vi måste hitta bättre former för förankringen i riksdagen. Men arbetet har påbörjats. Förankringen i civilsamhället och förankringen i Regeringskansliet på bredden har kommit en bra bit på väg.

(Applåder)

Anf.  44  SOFIA ARKELSTEN (M) replik:

Herr talman! De globala hållbarhetsmålen är, om man ska förenkla det, för allt som är bra och mot allt som är dåligt. Det är svårt att hitta politiska konflikter i detta. Men jag tycker ändå att det finns ett värde för väljarna i att få veta hur Socialdemokraterna ser på PGU, alltså den svenska samstämmighetspolitiken. Anser Maria Andersson Willner att det är rimligt att PGU blir som ett verktyg för att uppnå Agenda 2030? Vi landade rimligt i texterna i utrikesutskottet, men det är ändå intressant att få veta hur ni ser på PGU. Är det ett verktyg, eller är det ett politikområde i sin egen rätt?

Anf.  45  MARIA ANDERSSON WILLNER (S) replik:

Herr talman! Tack för frågan, Sofia Arkelsten!

PGU är ett verktyg för genomförandet av Agenda 2030 i kraft av sig självt och det riksdagen har fattat beslut om. Jag tycker att Yasmine Posio Nilsson från Vänsterpartiet sa det bra tidigare, nämligen att det dels handlar om att använda samstämmighet för att se till att genomföra Agenda 2030, dels handlar om vad vi kan göra utöver genomförandet i fråga om att identifiera målkonflikter och se till att politiken är samstämmig och levererar utifrån fattiga människors perspektiv och rättighetsperspektivet.

Anf.  46  SOFIA ARKELSTEN (M) replik:

Herr talman! Det är uppenbart att målkonflikterna lyser med sin frånvaro i skrivelsen från regeringen. Den är anekdotisk som bäst och handlar bara om att visa små exempel. Därför har regeringen inte tagit sitt ansvar för att gå in på djupet om vad som är PGU och vad som skulle kunna bli bättre.

Den intressanta frågan kan också vara hur regeringens ansvar ser ut för att PGU nedprioriteras. Det framgår av utskottets betänkande att inte ett enda annat utskott lämnat ett yttrande till oss. Det är verkligen tråkigt.

Vad anser Maria Andersson Willner att regeringen har för ansvar för att PGU har nedprioriterats till förmån för FN-målen?

Anf.  47  MARIA ANDERSSON WILLNER (S) replik:

Herr talman! Jag anser inte att regeringen på något vis har nedprioriterat PGU. Tvärtom har vi snarare upprioriterat och gjort en nystart. Nu finns ett konkret arbete på gång i regeringen.

Det vi diskuterar i dag är regeringens redovisning av det arbete som har gjorts för att leverera på av riksdagen beslutad PGU.

Det är intressant att Moderaterna och Sofia Arkelsten inte har några konkreta förslag om vad som skulle ha gjorts i stället. I reservation 1, som Moderaterna yrkar bifall till, tas bland annat handelsperspektivet upp. Det är vi helt överens om. Vi har gemensamma skrivningar i biståndsbudgeten som vi antog i höstas. Nästan ordagrant det som Sofia Arkelsten yrkar bifall till finns redan med.

Annars handlar det om form, form och form. Form är såklart oerhört viktigt, men när det kommer till politik har Moderaterna inte levererat några konkreta förslag om vad det är som borde ha gjorts i stället och vad regeringen inte har gjort – förutom det som vi redan är överens om.

Vad är förändringen i regeringens arbete med PGU? Nu kan Sofia Arkelsten tyvärr inte svara på frågan, men det hade varit intressant att få diskutera vad Moderaterna och Sofia Arkelsten menar när man säger att PGU har nedprioriterats. Mig veterligen ser denna redovisning exakt likadan ut som den förra regeringens redovisning av PGU. Det finns ingen förändring eller försämring i den delen.

Det finns inte heller några konkreta förslag på vad som borde ha gjorts och vad som inte har gjorts.

Anf.  48  KERSTIN LUNDGREN (C) replik:

Herr talman! En nystart för PGU gjordes. Var finns uppföljningen av PGU-nystarten? Vilka mål redovisas i skrivelsen från regeringen så att man kan följa vad nystarten innebär?

Riksdagen har lagt fast målen för PGU. De ska vara de fattiga människornas perspektiv, rättighetsperspektivet, mänskliga rättigheter, demokrati och rättsstatens principer. Var i skrivelsen följer man upp hur regeringen levt upp till målen i PGU?

PGU är inte ett verktyg utan PGU har lagt fast ett mål. Det är också målet för biståndspolitiken i budgeten. Skrivelsen som riksdagen har begärt har varit utifrån att vi ska få ta del av hur man följer upp målen. Var i den skrivelse som regeringen har presenterat kan vi följa upp målen? Var syns den uppföljningen tydligt?

Det har varit en tydlig debatt, herr talman, i kammaren. Ställer Socialdemokraterna upp på en parlamentarisk beredningsprocess för att säkerställa att det finns en tydlig målbild i den här kammaren över PGU och Agenda 2030?

Anf.  49  MARIA ANDERSSON WILLNER (S) replik:

Herr talman! Vad regeringen har gjort i fråga om nystarten handlar mycket om ökad kunskap, stärkt delaktighet och utvecklade verktyg för att jobba med PGU. Det arbetet har, som jag redan har nämnt, gjorts på ett genomgripande och strukturerat sätt i Regeringskansliet. Det vi skulle behöva göra är att ha denna process också i riksdagen. Det framgår i utskottets betänkande att inget annat utskott har valt att yttra sig. Det finns en representant från näringsutskottet här, och näringsutskottet har inte yttrat sig i frågan. Det är synd. Men det kan inte vara regeringens ansvar att näringsutskottet inte yttrar sig över en skrivelse om PGU.

Talmannen har förtjänstfullt försökt att öka kunskapen i riksdagen om PGU-frågorna vid ett seminarium. Det handlar inte om att ta över regeringens ansvar för förankringsprocessen, men det handlar om att vi i riksdagen måste ta ett eget ansvar för frågorna. Om man inte använder de möjligheter till påverkan som ändå finns i form av yttranden, egna förslag och tydlighet i debatten ligger ansvaret inte enbart på regeringen.

Sedan var det frågan om en parlamentarisk beredning. Den frågan är svår. Vi har varit eniga i utskottet – bortsett från Kerstin Lundgren och Centerpartiet – om att vi inte är beredda att tillstyrka en sådan beredning. Men vi måste fortsätta den dialogen. Det är kanske lösningen under nästa period. Vi får återkomma.

Anf.  50  KERSTIN LUNDGREN (C) replik:

Herr talman! En nystart för PGU handlar om att starta en ny process för att nå målen. När jag hör Maria Andersson Willner låter det snarare som att det är fråga om en nystart i Regeringskansliet om att resonera om målen – eller möjligen exempel. Det har funnits flera exempel. Måhända handlar det om kunskapsuppbyggnad.

Men riksdagen har fastlagt mål för PGU. PGU-skrivelsen handlar om att följa upp hur regeringen sköter målen. Det är den beställning riksdagen har gjort flera gånger, det vill säga grunden för en skrivelse om PGU att behandla här i dag. Men det finns inga mål att följa upp i skrivelsen. Det är beklagligt.

Jag har försökt att följa vad som har hänt med handlingsplanen som regeringen antog i går. Den kom upp på hemsidan för 20 timmar sedan, men nu finns den inte att se. Den är bortplockad – som det ser ut. Hur är handlingsplanen förankrad? Hur ser den ut? Det är allvarligt att riksdagen inte kan behandla nya målbilder. Regeringen har några månader före valet, utan förankring i riksdagen, trots signalerna från den egna delegationen, antagit en handlingsplan. Hållbarheten och långsiktigheten i den planen är kort.

Anf.  51  MARIA ANDERSSON WILLNER (S) replik:

Fru talman! Tack, Kerstin Lundgren! Jag är lite förvirrad – finns det eller finns det inte mål att följa upp?

Det finns mål fastlagda i PGU. Det här är regeringens svar på hur man har jobbat med de målen. Det är de svar vi har fått. Det är det vi har att diskutera. Det finns inga mål i skrivningen, så jag är lite förvirrad. Jag tycker att regeringen har gjort det som riksdagen har efterfrågat. Man har redovisat hur man jobbar med PGU och med de mål som finns där.

Nu tappade jag den sista frågan.

 

(KERSTIN LUNDGREN (C): 20 timmars hållbarhet.)

 

Just det! Vi diskuterar inte den nationella handlingsplanen i dag, men det är klart att det är olyckligt. Vi har väntat på den i utskottet. Jag har inte läst den; jag har ingen information om vad den innehåller. Den är inte en del av den här debatten. Det borde den kanske ha varit, men det är den inte.

Anf.  52  YASMINE POSIO NILSSON (V) replik:

Fru talman! I nyheterna i går visades ett reportage om Jemen. På ett sjukhus bar en mamma fram sitt barn till en stackars läkare som med väldigt knappa medel försökte hjälpa sjuka och skadade. Barnet som borde ha haft de där goa, tjocka, fasta låren hade de tunnaste små stickor som stack fram ur den löst sittande blöjan. Mitt föräldrahjärta brast av denna bild och ännu mer när jag tänkte på att vissa av de vapen som används i denna konflikt av den saudiskledda koalitionen är tillverkade här i Sverige. Det är en målkonflikt där den mänskliga rättigheten till ett säkert liv väger alltför lätt.

Min fråga till dig. Maria Andersson Willner, är: Har PGU verkligen gjort det avtryck som det borde göra, exempelvis på tillståndet att exportera krigsmateriel till Saudiarabien och Förenade Arabemiraten?

Anf.  53  MARIA ANDERSSON WILLNER (S) replik:

Fru talman! Tack, Yasmine Posio Nilsson, för möjligheten att utveckla detta! Jag tycker att det är ett bra exempel på när PGU faktiskt har effekt.

Vi har nu beslutat om en skärpning av krigsmateriellagstiftningen som innebär att det införs ett demokratikriterium – mottagarlandets demokratiska status ska i fortsättningen beaktas i helhetslösningen tillsammans med övriga faktorer som talar för och emot export. Det här har tillkommit, och efter en politisk process har det antagits av riksdagen. Det är ett svar på de utmaningar och problem vi har sett med krigsmaterielexport.

Sverige har en av de absolut tuffaste krigsmaterielexportlagarna i världen. Jag tycker att vi måste ha respekt för kammarens arbete och den nya lagstiftning som nu börjar gälla och invänta de resultat som skärpningen får. Om det inte blir någon förändring i tillämpningen får vi ta den diskussionen igen och se om vi behöver stärka lagstiftningen ytterligare. Men det här är ett gott exempel på när PGU fungerar som bäst. Vi hanterar de målkonflikter som kommer upp, och vi har stärkt lagstiftningen.

Anf.  54  YASMINE POSIO NILSSON (V) replik:

Fru talman! Tack för svaret, Maria Andersson Willner! Jag vill bara poängtera att PGU har funnits sedan 2003, och framtagandet av lagstiftning tog väldigt lång tid. Var det sju åtta år?

Den här lagstiftningen, som faktiskt kan vara den tuffaste i världen, är fortfarande inte för ett absolut stopp. Det är många tunga remissinstanser som ifrågasätter lagen och menar att det fortfarande finns kryphål. Denna kritik ställer vi i Vänsterpartiet oss bakom.

Det finns andra målkonflikter, som jag också tog upp i mitt anförande, till exempel migrationspolitiken. Det finns i dag kvinnor som vill säkerställa att de åtminstone inte blir gravida när de blir våldtagna under sin flykt. Därefter kan de inte komma vidare, för vi har en migrationspolitik som inte utgår från till exempel familjeåterförening. Där har vi ytterligare en målkonflikt.

Det jag vill försöka lyfta upp och poängtera i den här diskussionen är att jag vill ha PGU och Agenda 2030. På många punkter jobbar vi efter det. Men när det väl gäller, när vi kommer till tunga, viktiga beslut, faller PGU och Agenda 2030 alldeles för lätt till marken.

Anf.  55  MARIA ANDERSSON WILLNER (S) replik:

Fru talman! Jag är väldigt stolt över den enighet om PGU som finns i denna kammare och över den tidiga insats som Sverige gjorde när vi formulerade vår samstämmighetspolitik. Jag tycker att vi på många sätt kan vara stolta över det.

Det finns absolut saker kvar att göra. Den perfekta världen är inte här. Men genom att vi har en tydligt formulerad politik för global utveckling och genom att vi vågar definiera målkonflikter har vi också möjlighet att hantera dem.

Jag delar inte uppfattningen att PGU faller lätt till marken. Jag tycker att PGU hjälper oss att fatta kloka beslut, göra svåra avvägningar och – även när det är lätt att göra det – peka på att vi aldrig kan glömma världen runt omkring. Det finns stor och bred enighet om vikten av att se världen som en helhet och orka ta ansvar för beslut i denna kammare, i denna riksdag, som har inverkan världen över. Jag tycker att vi ska vara stolta över det arbete som görs med PGU.

Anf.  56  EMMA NOHRÉN (MP):

Fru talman! De senaste dagarna har vi kunnat läsa i tidningarna att flera av världens största och äldsta träd, baobabträd eller apbrödsträd som vi säger på svenska, plötsligt och oförutsett har dött. Det är träd som har levt i tusentals år. Man vet att de kan bli över 2 000 år gamla. De är 30 meter höga och kan bli lika breda som en buss. De har stort kulturellt värde och ger savannen en silhuett som många känner igen. De är också vattenreservoarer vid torka för både människor och djur. Deras enorma rötter kan sträcka sig långt ned och hitta vatten när det annars är torka överallt. Men nu dör de alltså, träden som har sett den moderna människan komma.

Faktum är att träddöd är en global trend. Även här i Europa har den förvärrats påtagligt sedan millennieskiftet. Vi har fått varmare somrar och nya nederbördsmönster.

I veckan har vi också nåtts av nyheten att Antarktis glaciärer försvinner allt snabbare. Vi ser inte längre en fördubbling utan en tredubbling av hur snabbt isarna smälter på bara ett decennium.

När det gäller oväder, både skyfall och orkaner, som ska komma med 500 års mellanrum har vi sett skyfall komma med ett års mellanrum och tre stora orkaner på ett och samma halvår. Jag tror inte att folk i Florida drar en lättnadens suck och säger: Ha, nu får vi inga fler orkaner på 1 500 år! Jag tror att de blir rädda.

Från Kalifornien kan vi se bilder på folk som målar sina gräsmattor gröna med sprejfärg eftersom man inte får vattna. Även i Sverige har vi gula gräsmattor och sinande brunnar, och det finns de som talar om nödslakt.

Bit läggs till bit. Det förändrade klimatet, som vi har pratat om så länge, börjar bli ett reellt hot. Det är inget som ligger långt fram i tiden och kommer att drabba oss om 50 år när vi alla är döda, som Carl Bildt en gång sa – kanske ett av världens slarvigaste och mest ansvarslösa uttalanden.

Klimatet förändras nu, och som vi i denna kammare vet är det de fattigaste som drabbas först. När vi i västvärlden, USA, Ryssland, Kenya och Indien släpper ut drabbar det globalt. Det är inte vi som drabbas hårdast av våra utsläpp. Vi får aldrig förlora världens fattiga som drabbas av detta, samtidigt som det är de som har bidragit minst.

Konsekvenserna kommer att vara kännbara. I västvärlden kan vi ofta räkna ut vad det kostar. Förra årets katastrofer i USA kostade till exempel 300 miljarder dollar. I de fattiga länderna görs inte de uppskattningarna, utan folk anpassar sig, flyttar eller flyr – eller svälter.

Vad jag vill ha sagt är nog tydligt. Klimatförändringarna är en av många utmaningar som visar varför PGU är så viktigt. Den visar att världen hänger ihop och att vi behöver ha en sammanhängande, samstämmig global politik för att vi ska kunna ta itu med den och andra utmaningar. Det duger inte att göra energieffektiviseringar i byggsektorn om vi samtidigt subventionerar flyg och fossila bränslen.

Jag var på ett seminarium om säkerhet runt Östersjön i måndags. Där sa man att det är paradoxalt att vi bygger vallar mot ökade vattenflöden av fossiltung cement. Det blir en loop där vi biter oss i svansen.

Det är så med många av de globala utmaningar vi står inför. Biståndet ensamt är inte tillräckligt för att bekämpa fattigdom. Här behövs alla politikområden, och man måste dra åt samma håll. Handelspolitik måste med, liksom skattepolitik, konfliktförebyggande och diplomati. Allt detta och mer därtill är viktiga redskap i det svåra men nödvändiga arbetet för att främja en hållbar utveckling, förpassa världsfattigdomen till historien och se till att alla människor får sina rättigheter tillgodosedda på samma sätt, var man än bor i världen.

Fru talman! När riksdagen klubbade PGU för 15 år sedan var Sverige ett av de första länderna i världen att anta en samstämmig politik för rättvis och global utveckling. Riksdagens alla partier var överens om en global och rättvis utveckling. Vi skulle, och ska, ta hänsyn till fattiga människors perspektiv och alla människors rättigheter.

Vi var också överens om att grundläggande målkonflikter ska redovisas och åtgärdas. Detta är en förutsättning för att vi ska få denna globala politik. Vi rönte internationell uppskattning då, och vi gör det fortfarande.

Men sedan den tiden har världen förändrats på fler sätt än jag kan räkna upp här. Vi har sett fantastiska resultat. Det är färre som är hungriga i dag än det var i går. Fler barn går i skolan. Färre kvinnor riskerar livet vid förlossningar, och fler kan läsa. Men vi ser också en tillbakagång i demokratiarbetet. Vi ser nya konfliktzoner, och vi ser att flertalet miljökurvor pekar åt fel håll.

Detta om något visar att PGU är lika relevant i dag som i går. Jag är glad över den enighet som fortfarande råder och över att vi här diskuterar formerna för PGU och viljan att vara med i PGU, snarare än att förändra den.

När den rödgröna regeringen tillträdde aviserade vi en nystart för PGU. Man såg att de ständiga målkonflikter som fanns var bromsklossar. Samordningen mellan departement var otillräcklig, och departementens kapacitet var ibland för låg för att de skulle kunna arbeta offensivt med PGU.

Därför har regeringen tillsatt en interdepartemental arbetsgrupp med PGU-ansvariga i chefsposition. Detta är en nyckel. Ansvaret måste ligga på chefen, inte på dem som har det vid sidan om. UD:s utrikesråd för internationellt utvecklingssamarbete fick i uppgift att leda chefsarbetet.

Regeringen har också gett varje departement i uppdrag att ta fram handlingsplaner för att se hur man ska arbeta med PGU. De ska innehålla konkreta och praktiska resultatmål för verksamheten och förslag på hur myndigheter som man har ansvar för ska involveras i arbetet.

I de återkommande skrivelserna hit till riksdagen redogör man för arbetet och ger en fördjupad analys av de tematiska områden som vi och regeringen anser vara särskilt viktiga för en global utveckling. Syftet med detta har varit att tydliggöra och hantera motsättningar mellan regeringens mål inom olika politikområden.

Fru talman! Det sammantagna resultatet av arbetet och dessa åtgärder ser vi nu: en ambitionshöjning på departementen. Det finns en gedigen systematik i hur arbetet bedrivs. Det är klart att det när man gör en omstart är lite knackigt i början, men vi ser nu att det börjar ta form. Det finns tydliga rutiner och mekanismer för uppföljning. Man ser att PGU-arbetet har blivit ett integrerat perspektiv.

Fru talman! Jag ber om ursäkt för att jag drar över tiden lite grann – jag har bara avslutningen kvar.

Agenda 2030 och de 17 globala målen, som antogs 2015, har gjort att vi i hela världen har en fantastisk och ambitiös vägvisare till en hållbar och rättvis värld. Agenda 2030 är vägen till omställningen för oss här hemma, men också för världen. Det ska den också vara lokalt.

Regeringens målsättning är att Sverige ska transformeras till världens första fossilfria välfärdsland. Det, om något, är en del av detta. Vi ska vara en internationell förebild när det gäller hållbar utveckling, och vi ska bedriva en politik som konsekvent tar hänsyn till fattiga människors perspektiv och mänskliga rättigheter.

PGU är därför ett centralt redskap för att genomföra de nya globala målen. Det hjälper regeringen att effektivisera arbetet mot de globala målen och minimerar risken för att regeringens arbete inom olika områden blir inbördes motverkande. Vi får mål och indikatorer på att det går åt rätt håll.

För att hela samhället ska vara delaktigt och framgångsrikt i arbetet måste vi ha en handlingsplan. Den antogs i går, och jag har inte sett den. Men jag hoppas att den kommer att göra att arbetet går framåt ännu mer. Jag ser att arbetet med PGU är en stor del av genomförandet av Agenda 2030, och jag ser med tillförsikt fram emot det fortsatta arbetet.

(Applåder)

Anf.  57  KERSTIN LUNDGREN (C) replik:

Fru talman! Varför vill inte regeringen vara en internationell förebild när det gäller att förankra och få beslut i riksdagen kring arbetet med Agenda 2030? Och varför är skrivelsen inte möjlig att följa upp? Om det nu har hänt så väldigt mycket i regeringen, varför är inte skrivelsen en berättelse om hur långt man har nått i förhållande till de mål som uppenbarligen finns där någonstans? De är inte synliga för oss här i kammaren eller i utskotten när vi ska yttra oss eller diskutera. Vi får det mer som en berättelse om ett antal exempel. Varför, är min fråga.

Anf.  58  EMMA NOHRÉN (MP) replik:

Fru talman! Tack, Kerstin Lundgren, för frågorna! Som vi har konstaterat här innehåller politiken för global utveckling och Agenda 2030 alla politikområden och ska genomsyra allt. I en skrivelse som ska redovisa hur vi jobbar på alla områden rakt över får man nog vara lite generell på vissa ställen och fördjupa där man vill visa exempel på hur man gör. Det skulle, tror jag, bli en omöjlig uppgift att varje eller vartannat år ta fram en skrivelse som täcker hela perspektivet.

Vad vi kan se är att regeringen har gjort en ansträngning och en nystart för PGU, vilket gör att det nu är ett pågående, resultatinriktat arbete som är uppföljbart vid alla departement, och att andra myndigheter har fått det uppdrag som departementen har. Det arbetet är systematiskt.

Jag kan inte heller se att den här PGU-skrivelsen är uppbyggd på något annat sätt än de tidigare. Kerstin Lundgren har ju suttit i utskottet mycket längre än jag, så jag skulle vilja fråga Kerstin Lundgren: Vad är det som skiljer denna skrivelse från de som andra regeringar har gjort i samband med sina uppföljningar?

Vi hör också att riksdagen inte har varit tillräckligt involverad. Med ett så stort ämne som Agenda 2030 och PGU finns det vissa delar där jag kan hålla med och där utskottet är enigt när det gäller just Agenda 2030 och handlingsplanen. Men på alla områden inom den har riksdagen varit otroligt engagerad. Den här regeringen är den som har gjort flest blocköverskridande överenskommelser. Ta arbetet i Miljömålsberedningen, som ledde fram till klimatlagen – där var alla politiker med. Detta är en del i hur vi uppnår klimatlagen.

Vi har Klimatpolitiska rådet. Vi har otroligt många saker. Vi har energiöverenskommelsen, där flera olika politiska partier är med. Alla dessa delar är en del i hur vi uppnår Agenda 2030. Riksdagen har också ett uppdrag att yttra sig, men inget annat utskott har bett att få yttra sig här.

Anf.  59  KERSTIN LUNDGREN (C) replik:

Fru talman! Om regeringen har gjort en nystart är den möjligen intern. Det är inte möjligt för oss att följa upp den. Var i skrivelsen redovisas de mål som regeringen har satt upp för nystarten och hur man har uppnått dem? Det är ju detta som är bekymret. Riksdagen ska kunna granska regeringen. Det är vårt uppdrag. Vi ska kunna följa upp och se att man lever upp till de mål som är fastlagda. Var syns detta i skrivelsen?

Exemplen handlar om att man arbetar med vattenfrågor – så trevligt! – eller om att man arbetar med något annat på något annat område. Så har inte tidigare skrivelser om PGU sett ut. Där har det varit tydligt vilka mål man har och vilka målkonflikter som kan finnas, och vi har haft en möjlighet att följa upp. Ett av problemen är att någon sådan möjlighet för kammaren inte finns med dagens skrivelse. Det är väl detta som gör att alla utskott känt sig bara lite lagom engagerade: Man vet ju inte riktigt vad man ska tycka om ett antal exempel. Ska man tillföra ytterligare något? Nej, det är ju inte det som är riksdagens roll.

Riksdagen ska granska och fatta beslut när det gäller att styra och ge grunderna för regeringen, men regeringen har antagit en handlingsplan som riksdagen inte ens har sett. Handlingsplanen antogs dagen innan vi har denna debatt i kammaren. Detta säger mycket om regeringens relation till riksdagen i den här frågan.

(Applåder)

Anf.  60  EMMA NOHRÉN (MP) replik:

Fru talman! Jag skulle nog vilja skicka tillbaka frågan till Kerstin Lundgren. Om man nu känner sig så utanför i det arbete som har bedrivits, varför då inte använda de möjligheter som finns i utskottet att göra bedömningar och inspel när det gäller skrivelsen? Den möjligheten har alla utskott haft, men inget har valt att utnyttja den. Det ansvaret ligger ju också på riksdagen.

Sedan har vi en samsyn i utskottet om att det har skett en för svag förankring i förhållande till de förväntningar som fanns rörande handlingsplanen för Agenda 2030, men det är ju inte denna som är föremål för debatten i dag, utan det är skrivelsen.

Regeringen har gett SCB i uppgift att ta fram uppföljningsmaterial och statistik om hur arbetet med Agenda 2030 går. Det blir en extern granskning som jag tror att vi alla kan följa upp. Arbetet pågår och fortsätter. Jag tror att vi kan känna tillförsikt om att arbetet går åt det håll som vi vill.

Anf.  61  FREDRIK MALM (L):

Fru talman! Detta handlar om mycket stora och breda områden som komprimeras i en skrivelse utifrån något luddiga målsättningar. Men låt mig börja i det som borde vara centralt för oss som demokratiska politiker, nämligen den breda attack mot demokratiska värderingar som pågår på många håll i världen. Demokratin utmanas i det som är dess heartland, där demokratin så att säga har fötts, vuxit fram, blivit stark och präglat samhällena, inte minst i Västeuropa. Vi ser en tillbakagång i flera länder i Östeuropa som varit demokratier i ett antal årtionden sedan Sovjetunionens fall. Sedan finns det auktoritära stater och delvis ofria länder där man ser en auktoritär utveckling. Turkiet är ett exempel på det.

Detta är väldigt oroväckande. I grunden förutsätter den världsordning som jag som liberal vill se att man håller sig till ingångna avtal, att det finns globala regelverk och att det finns folkvalda parlament och en oberoende, fri press och så vidare. Om hörnpelarna för vår demokratiska civilisation utmanas är det väldigt allvarligt.

Detta hänger ihop med en rad andra problem i världen, inte minst militära konflikter i Syrien, Libyen, Jemen och så vidare. De föder i sin tur migrationsströmmar och flyktingvågor som på olika sätt triggar högerpopulistiska motreaktioner i våra länder.

När man tittar på utvecklingspolitik och frågor som gäller global utveckling är det viktigt att man ser hur dessa olika processer på olika sätt påverkar varandra: Ekonomi, handel, konflikter, bistånd och migration påverkar varandra.

Därtill är en viktig förutsättning för att vår svenska och europeiska demokrati ska fungera att också Europasamarbetet fungerar. Vi ser nu hur det blir alltmer ansträngt. Vi hade en svår finanskris i Europa tidigare. Vi hade den omfattande flyktingkrisen 2015. Ett stort medlemsland förhandlar nu om att lämna Europeiska unionen. Vi står inför en betydande utmaning internt i Europeiska unionen för att få samarbetet att fungera bättre. Det finns väldigt många utmaningar som på olika sätt överlappar och påverkar varandra och så vidare.

Sverige har haft en politik för global utveckling sedan 2002 eller 2003. Det här ärendet syftar ju till att på olika sätt nå en samstämmighet när det gäller detta. Jag konstaterar att skrivelsen är aningen luddig. Handlingsplanen kom först i går, och sedan försvann den för att sedan komma tillbaka. Det är lite svårt att ta fasta på de grundläggande diskussionerna om PGU och dess framtid i detta. I grova drag uppfattar jag att det finns ett stöd i riksdagen för en ambitiös och långsiktig politik för global utveckling.

Jag tycker dock att vi måste vara ödmjuka och se att det också finns en hel del målkonflikter här. De grundar sig också i det faktum att vi är åtta partier i riksdagen. Jag lyssnade på Vänsterpartiets – deras talare är inte kvar här i salen – långa uppräkning av allt som inte fungerar. Hon undrade hur det kommer sig att vi har vapenexport och att det finns krig när vi har PGU. Men vi måste vara ödmjuka och inse att bara för att riksdagen har fattat beslut om en politik för global utveckling betyder det inte att alla intressekonflikter i politiken – mellan höger och vänster, liberaler och socialister i olika frågor – bara försvinner.

Jag representerar ett parti som är varma anhängare av ett Europasamarbete. Samtidigt finns det i riksdagen partier som vill att Sverige ska lämna EU. Då kan vi inte vara helt överens om vad som främjar utveckling i världen. Vi måste vara ödmjuka inför det faktum att det alltid kommer att finnas intressemotsättningar. De behandlas ju i riksdagen hela tiden, i alla betänkanden, debatter, lagförslag och annat. Det täcks dock inte riktigt in av det här betänkandet, om man säger så.

Med detta sagt får vi lägga skrivelsen till handlingarna.

 

Överläggningen var härmed avslutad.

(Beslut skulle fattas den 19 juni.)

§ 9  Riksrevisionens rapport om Sida-finansierad myndighetssamverkan

 

Utrikesutskottets betänkande 2017/18:UU23

Riksrevisionens rapport om Sida-finansierad myndighetssamverkan (skr. 2017/18:219)

föredrogs.

 

Förste vice talmannen konstaterade att ingen talare var anmäld.

(Beslut skulle fattas den 19 juni.)

§ 10  Utredningar för att förebygga vissa skador och dödsfall

 

Socialutskottets betänkande 2017/18:SoU36

Utredningar för att förebygga vissa skador och dödsfall (prop. 2017/18:215)

föredrogs.

Anf.  62  KARIN RÅGSJÖ (V):

Fru talman! Det är inte parken som är farligast för en kvinna eller ett barn, utan det är hemmiljön. Det är inte okända människor utan de som står nära som är farligast. Det är förstås extra traumatiskt och hotande.

Det är viktigt att utreda brotten mot barn och vuxna för att kunna se ett mönster. Vad var det som hände? Eller snarare: Vad var det som inte hände som kunde ha förhindrat brottet? Hur ska samhället, hälso- och sjukvård, socialtjänst och skola kunna se bakom kulisserna för att förebygga våld mot barn och kvinnor?

Regeringen föreslår i propositionen Utredningar för att förebygga vissa skador och dödsfall vissa ändringar. Utredningsverksamheten ska utökas till att omfatta fler fall än vad den nuvarande lagstiftningen säger.

Också fall där barn utsatts för synnerligen grov misshandel av en till barnet närstående person eller tidigare närstående person ska utredas. Fall som rör vuxna där brottet utgör försök, förberedelse eller stämpling till mord eller dråp ska utredas om brottet begåtts av närstående eller tidigare närstående person. Det är väldigt viktigt för att se händelseförloppet.

Vänsterpartiet välkomnar att regeringen nu väljer att lägga fram en proposition där steg mot ett mer systematiskt utredningsarbete av vissa skador och dödsfall tas. Det är viktigt att dessa brott utreds av många skäl, för den enskilde, för anhöriga och också för att samhället i stort ska kunna dra slutsatser. Många barn är skyddslösa i sina hem.

Att fler barn utreds med den tydliga avsikten att förebygga våld är oerhört bra, detta med tanke på att Sverige nu har antagit barnkonventionen till lag. I artikel 19 anges att länder ska vidta alla lämpliga åtgärder för att skydda barn mot alla former av våld.

Vänsterpartiet har under flera års tid lagt förslag i riksdagen om att tillsätta en haverikommission som ska se över varje fall där en kvinna har mördats eller misshandlats till döds av en närstående man. En liknande lagstiftning infördes 2007 när det gällde barn som dödats av närstående. Därför var det positivt att riksdagen beslutade att även dödligt våld mellan närstående vuxna ska utredas.

Syftet med utredningsverksamheten ska vara att ge underlag för förslag till åtgärder som förebygger att kvinnor och män utsätts för våld eller andra övergrepp av närstående eller tidigare närstående personer. Sådant våld är ju väldigt vanligt, tyvärr.

Alla fall av dödligt våld ska omfattas, oavsett kön på offer eller förövare. Socialstyrelsen publicerade 2014 en första rapport om vuxna som avlidit med anledning av brott begångna av en närstående eller tidigare närstående person. Socialstyrelsen påpekar i rapporten att det begränsade antalet ärenden gör det svårt att dra generella slutsatser, men man återkom till vissa brister.

Vanliga brister är att socialtjänsten känt till att kvinnan varit utsatt för våld men valt att inte utreda detta, att insatser som placering på skyddat boende inte utgår från individens behov och att samverkan varit bristfällig eller obefintlig, såväl internt inom socialtjänsten som externt. Vi har en del att göra. 269 kvinnor har dödats av sin man eller exman under 2000-talet. Minst 16 kvinnor dödades förra året, 2017. Nivån har varit densamma under hela 2000-talet.

Självmord till följd av psykisk misshandel av en närstående omfattas inte av den nya lagen. Vi inom Vänstern anser att både självmord och självmord där det finns misstanke om att dödsfallet föregåtts av hot och påtryckningar exempelvis av hedersrelaterad karaktär ska utredas.

Också flertalet av de remissinstanser som svarat har kritiserat att regeringen valt att lämna självmord utanför förslaget. Folkhälsomyndigheten rapporterar att i genomsnitt 129 barn och ungdomar mellan 15 och 24 år begick självmord varje år mellan 2012 och 2014. Det är, som sagt, mycket som kan göras.

Att även självmord ska utredas i syfte att uppmärksamma den egentliga orsaken till dödsfallet och därmed i förlängningen kunna förebygga att barn och kvinnor far illa är oerhört viktigt. Denna uppfattning är inte bara vår, fru talman, utan den delas av såväl Rädda Barnen som Sveriges Kvinnolobby, Roks och Barnombudsmannen. De har tagit upp detta i sina remissvar.

Vänsterpartiet instämmer i det som Barnombudsmannen skriver:

Det förekommer att våld och kränkningar är bidragande orsaker till självmord eller oklara dödsfall. Oavsett orsak är varje barns självmord ett allvarligt misslyckande för samhället, och vid oklara dödsfall och självmord kan det finnas systematiska luckor i samhällets skydd av barn som kan förbättras. Det är det som vi vill komma åt genom att se vad samhället kan göra mer för att få ned dödstalen när det gäller självmord.

Inte heller självmord som kan misstänkas vara resultat av hedersrelaterat förtryck föreslås omfattas av utredning, något som Vänsterpartiet också motionerat om. Det är olyckligt och borde inkluderas i propositionen. Också Sveriges Kvinnolobby har uppmärksammat det faktum att många lämnas utanför med det aktuella förslaget, inte minst de som lever i en hederskontext.

Sveriges Kvinnolobby skriver så här:

Kvinnojourerna erfar att våld som sker i hederns namn kan ske genom gärningar som inte innefattas i vare sig rådande eller föreslagen reglering. Våldet kan ske genom påtryckningar, hot, tvång och självmord. Det gäller särskilt de uppmärksammade fallen med mord genom fall från balkonger där förundersökning inte inleds eftersom det tidigt bedöms röra sig om en olycka eller ett självmord. Dessa barn har i allra högsta grad ett skyddsbehov.

Förslagen som läggs i propositionen är sådana som Vänsterpartiet efterfrågat. Vi tycker att det blir en bra lagstiftning, men med det som jag har sagt tidigare hade vi önskat att regeringen hade återkommit med förslag till lagstiftning som innebär att självmord ska omfattas av utredningsförfarandet.

Jag yrkar bifall till utskottets förslag i betänkandet, men jag yrkar också bifall till reservation 1.

Tack, det här var mitt sista lilla speech för den här säsongen!

(Applåder)

Anf.  63  CHRISTINA ÖRNEBJÄR (L):

Fru talman! Dödsfallsutredningar är ett viktigt redskap i arbetet för att förbättra samhällets möjligheter att förebygga våld i nära relationer mot både barn och vuxna. I den här propositionen föreslås nu att lagen om utredningar avseende vissa dödsfall utökas till att omfatta fler fall än där barn och vuxna har avlidit. Det innebär att det kan handla om mer än dödsfallsutredningar.

Fall där barn utsatts för grov eller synnerligen grov misshandel ska omfattas om brottet har begåtts av en närstående eller en tidigare närstående. När det gäller vuxna ska försök, förberedelse eller stämpling till mord eller dråp utredas om det har begåtts av en närstående eller en tidigare närstående person.

Mycket av detta ligger i linje med vad Liberalerna tidigare har motionerat om när det gäller ökat skydd och utvidgat brottsofferbegrepp. För oss liberaler är det därför viktigt att även barn som upplevt våld inkluderas. I sammanhanget bör det kanske påpekas att för barn, barns utveckling och barns psykiska hälsa är den psykiska misshandeln precis lika illa som den fysiska.

I likhet med flera barnrättsorganisationer – Gapf, Glöm aldrig Pela och Fadime, länsstyrelsen i Östergötland och flera andra utredningar – menar vi att utredningsverksamheten bör utökas till att gälla fler brott än dem som regeringen nu föreslår, nämligen självmord, grov våldtäkt där förövaren är en närstående eller tidigare närstående samt könsstympning.

I de fall där utredningar enligt den här lagen görs med anledning av brott mot en vuxen och där det finns barn med som har upplevt våldet ska utredningen även omfatta vilka åtgärder som har vidtagits eller hade kunnat vidtas för att skydda barnet. Det här gäller också när en utredning görs med anledning av brott mot ett barn där andra barn har upplevt våldet.

Som tidigare nämnts här i talarstolen i dag är hedersproblematiken någonting som har fått större uppmärksamhet de senaste åren. Detta är också någonting som vi i Liberalerna tar på största allvar.

Vi ser tyvärr att hedersproblematiken inte kommer att täckas in i liggande förslag när närståendebegreppet är så snävt som det är. Flera remissinstanser har påpekat att närståendebegreppet borde utvidgas och förtydligas för att man ska vara säker på att hedersrelaterat våld omfattas av utredningsverksamheten, vilket vi liberaler också tycker.

Regeringen skriver i propositionen att det i tidigare förarbeten finns uttalanden om att begreppet ”närstående” inte bör tolkas alltför snävt. Vi liberaler menar dock att detta inte riktigt är tillräckligt; i stället borde det stå att begreppet ”närstående” bör tolkas tillräckligt brett för att kunna täcka in detta.

Någonting annat som behöver lyftas upp är att på samma sätt som den som utreder barnärenden bör ha särskild barnkompetens behövs det särskild kompetens gällande hedersproblematik. Det är strukturer man behöver känna till för att kunna utreda just denna typ av brott.

Fru talman! Liberalerna har i tidigare motioner framfört att utredningar bör kunna riktas mot myndigheters agerande i enskilda fall, som en haverikommission eller en lex Lotta. Att granska det enskilda fallet handlar om att bedöma hur polis och åklagare har agerat men också vad till exempel socialtjänsten och vården har gjort.

Man behöver kunna granska vad som var känt på förhand om både gärningsman och offer. I dag kan Socialstyrelsen exempelvis inte ta del av rättspsykiatriska undersökningar eller andra handlingar som rör en gärningsperson.

I ett svar på en skriftlig fråga från min partikollega Roger Haddad sa justitieministern att regeringen såg positivt på förslaget om att införa en lex Lotta. Något sådant förslag har dock tyvärr inte beretts inom ramen för detta ärende. Vi beklagar det, för detta hade varit ett gyllene tillfälle att få igenom just en lex Lotta.

Fru talman! I onsdags tog vi ett historiskt beslut här i kammaren. Det var ett tillfälle när det kändes extra stort och viktigt att få vara med och trycka på den gröna knappen. Vi tog nämligen beslut om att barnkonventionen ska bli lag.

Att fler barn med denna proposition utreds med den tydliga avsikten att förebygga våld är självklart positivt ur alla aspekter. En av dem är artikel 19 i barnkonventionen, som säger att de som har skrivit under barnkonventionen ska vidta alla lämpliga åtgärder för att skydda barn mot alla former av våld. Det är här som även den psykiska misshandeln kommer in.

Med tanke på onsdagens beslut kan jag tycka att det är lite tråkigt att man inte i övrigt kopplar förslaget tydligare till barnkonventionen. Jag tror att det hade varit en styrka i detta förslag och också visat på allvaret med att göra barnkonventionen till lag.

Avslutningsvis: Förslaget är i stor utsträckning i linje med vad vi liberaler tidigare har motionerat om, och vi är positiva till det. På några punkter menar vi att regeringen borde ha gått längre, men i grunden är detta ett bra förslag. Det är ett bra förslag för att stärka barns rättigheter och i förlängningen förebygga att barn utsätts för dödligt våld eller misshandel.

Därför yrkar jag bifall till förslaget i betänkandet men också till reservationerna 2 och 3.

(Applåder)

Anf.  64  KRISTINA NILSSON (S):

Fru talman! Varje gång ett barn eller en vuxen avlider till följd av våld är en oerhörd tragedi. Särskilt mycket tror jag att vi alla känner när det gäller barn och om brottet har begåtts av den som egentligen borde skydda och vårda barnet, även om allt våld självfallet är förkastligt.

När detta ofattbara händer börjar vi nog alla att tänka, oavsett var vi befinner oss och vad vi gör, oavsett om vi är anställda inom sjukvården, socialtjänsten eller polisen och oavsett om vi är politiker, boende i närområdet eller läser om det hemska i medierna.

Som politiker tror jag att vi alla vill göra allt vi kan för att förebygga och förhindra att sådant här över huvud taget händer. Jag vet att det görs mycket ute i samhället, men mycket mer behöver göras.

Sedan 2008 ska Socialstyrelsen utreda fall då ett barn avlidit till följd av ett brott. År 2012 utvidgades denna lag till att även omfatta fall när en vuxen avlidit till följd av ett brott som begåtts av en närstående eller tidigare närstående.

Sedan denna lag trädde i kraft har 46 barnärenden och 52 vuxenärenden utretts. Under perioden 2016–2017 var det 6 barnärenden och 21 vuxenutredningar.

Det som föreslås i dag är att fler fall än sådana där barn och vuxna har avlidit ska utredas. När det gäller vuxna ska fall där brottet utgörs av försök, förberedelse eller stämpling till mord utredas om brottet har utförts av en närstående eller tidigare närstående person.

När det gäller barn ska en utredning genomföras vid grov eller synnerligen grov misshandel om brottets har begåtts av en närstående. Om brottet utgör försök, förberedelse eller stämpling till mord, dråp eller barnadråp ska det utredas oavsett vilken relation gärningsmannen har eller har haft till barnet.

För att klargöra vad utredningsverksamheten ska leda till vill regeringen nu tydliggöra att syftet med utredningarna är att ge regeringen underlag för att fatta beslut om åtgärder som har till mål att förebygga att barn far illa eller att kvinnor och män utsätts för våld av en närstående.

Utredningen ska klarlägga händelseförloppet som föregått en sådan händelse, möjliga orsaker till händelsen samt vilka åtgärder som har vidtagits eller hade kunnat vidtas för att skydda barnet eller den vuxne.

Man kan konstatera att det antal fall som utretts med nuvarande lagstiftning är litet och att det är mycket svårt att med stöd av slutsatserna från just denna utredningsverksamhet dra slutsatser på systemnivå och generellt förbättra det förebyggande arbetet.

Enligt regeringen kommer den utökade utredningsverksamheten att leda till att ca 80 fler fall per år kommer att utredas och adderas till dagens 15 och därmed utgöra ett bättre underlag för slutsatser och underlag för framtida beslut. Vi kommer helt enkelt att lättare kunna identifiera brister i samhällets skyddsnät och därmed på ett bättre sätt kunna göra något åt dem.

Socialstyrelsen ska även fortsättningsvis ansvara för utredningarna men kan vid behov anlita experter och sakkunniga.

När det gäller frågan om vad som ska omfattas av utredningarna delar majoriteten av utskottet bedömningen att det finns en gräns för hur många utredningar som kan hanteras enligt denna lag utan att riskera lagens krav på effektivitet och ändamålsenlighet.

När det gäller begreppet ”närstående” är det brottsbalkens definition av vad som menas med närstående som styr vilka fall som ska utredas. Att ändra närståendebegreppet i lagen om utredning av vissa skador och dödsfall låter sig inte göras utan att konsekvenserna av en sådan lagändring utreds närmare.

Dock anses det i förarbetena till brottsbalken att begreppet inte bör tolkas alltför snävt. Där resoneras det utifrån att närstående främst, men inte enbart, avser en rad uppräknade personer.

Det är självfallet oerhört viktigt att regeringen följer denna fråga noga för att så snart som möjligt se om det finns ett behov av att begreppet ”närstående” utreds närmare för att senare eventuellt ändras.

Fru talman! Som jag sa inledningsvis är varje inträffat fall av våld utfört av en närstående ett fall för mycket. Jag är ganska övertygad om att vi alla, oavsett parti och oavsett regering, verkligen med hela vårt hjärta vill göra vad vi kan för att förhindra att barn far illa och i värsta fall dör på grund av våld.

Denna lagändring är en liten men väldigt viktig pusselbit på vägen för att på ett effektivare sätt kunna utveckla det förebyggande arbetet.

Eftersom detta också är min sista stund i talarstolen för mandatperioden vill jag passa på att tacka mina utskottskollegor samt talmannen och presidiet för denna mandatperiod.

Jag yrkar bifall till förslaget i betänkandet och avslag på reservationerna.

(Applåder)

 

Överläggningen var härmed avslutad.

(Beslut skulle fattas den 19 juni.)

§ 11  Anpassningar av svensk rätt till EU-förordningen om kliniska läkemedelsprövningar

 

Socialutskottets betänkande 2017/18:SoU29

Anpassningar av svensk rätt till EU-förordningen om kliniska läkemedelsprövningar (prop. 2017/18:196)

föredrogs.

 

Förste vice talmannen konstaterade att ingen talare var anmäld.

(Beslut skulle fattas den 19 juni.)

§ 12  Anmälan om interpellation

 

Följande interpellation hade framställts:

 

den 14 juni

 

2017/18:591 Svarta hål i rymdstrategin

av Mathias Sundin (L)

till statsrådet Helene Hellmark Knutsson (S)

§ 13  Anmälan om frågor för skriftliga svar

 

Följande frågor för skriftliga svar hade framställts:

 

den 14 juni

 

2017/18:1484 Tidigarelagd slåtter av vall

av Magnus Oscarsson (KD)

till statsrådet Sven-Erik Bucht (S)

2017/18:1485 Ministrarnas närvaro vid debatter

av Markus Wiechel (SD)

till statsminister Stefan Löfven (S)

2017/18:1486 Rovdjurspolitik för en levande landsbygd

av Christian Holm Barenfeld (M)

till statsrådet Sven-Erik Bucht (S)

2017/18:1487 Antalet vargar i Sverige

av Christian Holm Barenfeld (M)

till miljöminister Karolina Skog (MP)

2017/18:1488 Vargstammens påverkan på landsbygden

av Christian Holm Barenfeld (M)

till miljöminister Karolina Skog (MP)

2017/18:1489 Bekämpning av oseriösa fiberleverantörer

av Jasenko Omanovic (S)

till statsrådet Peter Eriksson (MP)

2017/18:1490 Bedömning av reell kompetens

av Betty Malmberg (M)

till statsrådet Helene Hellmark Knutsson (S)

2017/18:1491 Telias köp av TV4 och riskerna för konkurrensen och nätneutraliteten

av Carl Schlyter (MP)

till närings- och innovationsminister Mikael Damberg (S)

2017/18:1492 En översyn av informationsplikten för personer som lever med hiv

av Robert Hannah (L)

till socialminister Annika Strandhäll (S)

2017/18:1493 Avsaknad av kvalitetsgranskning av polisutbildningen

av Roger Haddad (L)

till justitie- och inrikesminister Morgan Johansson (S)

§ 14  Kammaren åtskildes kl. 12.49.

 

 

Sammanträdet leddes

av talmannen från dess början till och med § 8 anf. 50 (delvis) och

av förste vice talmannen därefter till dess slut.

 


Innehållsförteckning


§ 1  Justering av protokoll

§ 2  Anmälan om återtagande av plats i riksdagen

§ 3  Ärenden för hänvisning till utskott

§ 4  Ärenden för bordläggning

§ 5  Energipolitikens inriktning

Näringsutskottets betänkande 2017/18:NU22

Anf.  1  SOFIA FÖLSTER (M)

Anf.  2  MATTIAS BÄCKSTRÖM JOHANSSON (SD)

Anf.  3  RICKARD NORDIN (C)

Anf.  4  BIRGER LAHTI (V)

Anf.  5  MARIA WEIMER (L)

Anf.  6  PENILLA GUNTHER (KD)

Anf.  7  PATRIK ENGSTRÖM (S)

Anf.  8  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik

Anf.  9  PATRIK ENGSTRÖM (S) replik

Anf.  10  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik

Anf.  11  PATRIK ENGSTRÖM (S) replik

Anf.  12  RICKARD NORDIN (C) replik

Anf.  13  PATRIK ENGSTRÖM (S) replik

Anf.  14  RICKARD NORDIN (C) replik

Anf.  15  PATRIK ENGSTRÖM (S) replik

Anf.  16  LISE NORDIN (MP)

Anf.  17  RICKARD NORDIN (C) replik

Anf.  18  LISE NORDIN (MP) replik

Anf.  19  RICKARD NORDIN (C) replik

Anf.  20  LISE NORDIN (MP) replik

Anf.  21  Statsrådet IBRAHIM BAYLAN (S)

Anf.  22  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik

Anf.  23  Statsrådet IBRAHIM BAYLAN (S) replik

Anf.  24  MATTIAS BÄCKSTRÖM JOHANSSON (SD) replik

Anf.  25  Statsrådet IBRAHIM BAYLAN (S) replik

Anf.  26  MARIA WEIMER (L) replik

Anf.  27  Statsrådet IBRAHIM BAYLAN (S) replik

Anf.  28  MARIA WEIMER (L) replik

Anf.  29  Statsrådet IBRAHIM BAYLAN (S) replik

Anf.  30  SOFIA FÖLSTER (M) replik

Anf.  31  Statsrådet IBRAHIM BAYLAN (S) replik

Anf.  32  SOFIA FÖLSTER (M) replik

Anf.  33  Statsrådet IBRAHIM BAYLAN (S) replik

Anf.  34  RICKARD NORDIN (C) replik

Anf.  35  Statsrådet IBRAHIM BAYLAN (S) replik

Anf.  36  RICKARD NORDIN (C) replik

Anf.  37  Statsrådet IBRAHIM BAYLAN (S) replik

(Beslut skulle fattas den 19 juni.)

§ 6  Elmarknadsfrågor

Näringsutskottets betänkande 2017/18:NU23

(Beslut skulle fattas den 19 juni.)

§ 7  Solidaritet vid kris i naturgasförsörjningen

Näringsutskottets betänkande 2017/18:NU27

(Beslut skulle fattas den 19 juni.)

§ 8  Politiken för global utveckling (PGU)

Utrikesutskottets betänkande 2017/18:UU21

Anf.  38  SOFIA ARKELSTEN (M)

Anf.  39  JULIA KRONLID (SD)

Anf.  40  KERSTIN LUNDGREN (C)

Anf.  41  YASMINE POSIO NILSSON (V)

Anf.  42  PENILLA GUNTHER (KD)

Anf.  43  MARIA ANDERSSON WILLNER (S)

Anf.  44  SOFIA ARKELSTEN (M) replik

Anf.  45  MARIA ANDERSSON WILLNER (S) replik

Anf.  46  SOFIA ARKELSTEN (M) replik

Anf.  47  MARIA ANDERSSON WILLNER (S) replik

Anf.  48  KERSTIN LUNDGREN (C) replik

Anf.  49  MARIA ANDERSSON WILLNER (S) replik

Anf.  50  KERSTIN LUNDGREN (C) replik

Anf.  51  MARIA ANDERSSON WILLNER (S) replik

Anf.  52  YASMINE POSIO NILSSON (V) replik

Anf.  53  MARIA ANDERSSON WILLNER (S) replik

Anf.  54  YASMINE POSIO NILSSON (V) replik

Anf.  55  MARIA ANDERSSON WILLNER (S) replik

Anf.  56  EMMA NOHRÉN (MP)

Anf.  57  KERSTIN LUNDGREN (C) replik

Anf.  58  EMMA NOHRÉN (MP) replik

Anf.  59  KERSTIN LUNDGREN (C) replik

Anf.  60  EMMA NOHRÉN (MP) replik

Anf.  61  FREDRIK MALM (L)

(Beslut skulle fattas den 19 juni.)

§ 9  Riksrevisionens rapport om Sida-finansierad myndighetssamverkan

Utrikesutskottets betänkande 2017/18:UU23

(Beslut skulle fattas den 19 juni.)

§ 10  Utredningar för att förebygga vissa skador och dödsfall

Socialutskottets betänkande 2017/18:SoU36

Anf.  62  KARIN RÅGSJÖ (V)

Anf.  63  CHRISTINA ÖRNEBJÄR (L)

Anf.  64  KRISTINA NILSSON (S)

(Beslut skulle fattas den 19 juni.)

§ 11  Anpassningar av svensk rätt till EU-förordningen om kliniska läkemedelsprövningar

Socialutskottets betänkande 2017/18:SoU29

(Beslut skulle fattas den 19 juni.)

§ 12  Anmälan om interpellation

§ 13  Anmälan om frågor för skriftliga svar

§ 14  Kammaren åtskildes kl. 12.49.