Regeringens proposition 2013/14:239

EU:s tåg-, fartygs- och

Prop.

busspassagerarförordningar

2013/14:239

– tillsyn och sanktioner

 

Regeringen överlämnar denna proposition till riksdagen.

Stockholm den 5 juni 2014

Fredrik Reinfeldt

Beatrice Ask

(Justitiedepartementet)

Propositionens huvudsakliga innehåll

I EU:s tåg-, fartygs- och busspassagerarförordningar får resenärer vissa rättigheter och transportörer vissa skyldigheter. Det handlar bl.a. om rätt till ersättning och information vid förseningar och krav på åtgärder för att underlätta resandet för personer med funktionsnedsättning eller nedsatt rörlighet. Bestämmelserna är direkt tillämpliga i Sverige.

Medlemsstaterna ska utse tillsynsmyndigheter och fastställa sanktioner som ska gälla vid överträdelser av förordningarna. I propositionen föreslår regeringen bestämmelser om tillsyn och sanktioner. Bestämm- elserna föreslås bli införda i en ny lag med kompletterande bestämmelser till passagerarförordningarna.

I den nya lagen får dessutom regeringen uppgiften att utse bussterm- inaler där det ska finnas assistans för personer med funktionsnedsättning eller nedsatt rörlighet i enlighet med busspassagerarförordningen. Reger- ingen får överlämna uppgiften åt en statlig myndighet eller en regional kollektivtrafikmyndighet.

Vidare föreslår regeringen ändringar i lagen om lufttransporter. Genom ändringarna införs sanktioner vid överträdelser av EU-rättsliga bestämm- elser om prissättning.

Den nya lagen och lagändringarna föreslås träda i kraft den 1 januari 2015.

1

Prop. 2013/14:239 Innehållsförteckning

1

Förslag till riksdagsbeslut .................................................................

4

2

Lagtext

..............................................................................................

5

 

2.1

Förslag till lag med kompletterande bestämmelser

 

 

 

till EU:s tåg - , fartygs - och

 

 

................................................

busspassagerarförordningar

5

 

2.2

Förslag till lag om ändring i lagen (1970:417) om

 

 

. ......................................................

marknadsdomstol m.m

7

 

2.3

Förslag till lag om ändring i lagen (1992:1672) om

 

 

...........................................................................

paketresor

9

 

2.4

Förslag till lag om ändring i järnvägslagen

 

 

........................................................................

(2004:519)

10

 

2.5

Förslag till lag om ändring i marknadsföringslagen

 

 

........................................................................

(2008:486)

12

 

2.6

Förslag till lag om ändring i lagen (2010:510) om

 

 

...................................................................

lufttransporter

13

 

2.7

Förslag till lag om ändring i järnvägstrafiklagen

 

 

........................................................................

(1985:192)

16

 

2.8

Förslag till lag om ändring i lagen (1985:193) om

 

 

.............................................

internationell järnvägstrafik

17

 

2.9 ..........

Förslag till lag om ändring i sjölagen (1994:1009)

18

 

2.10

Förslag till lag om ändring i lagen (2006:1116) om

 

 

......................................

information till passagerare m.m

19

3

Ärendet ............................................................och dess beredning

20

4

Tåg-, fartygs ...........................- och busspassagerarförordningarna

21

5

Tillsyn .....................................................................och sanktioner

28

6

Befogenhet .................................................att utse bussterminaler

37

7

Ikraftträdande..................................................................................

38

8

Ekonomiska .............................................och andra konsekvenser

39

9

Författningskommentar...................................................................

40

 

9.1

Förslaget till lag med kompletterande bestämmelser

 

 

 

till EU:s tåg - , fartygs - och

 

 

..............................................

busspassagerarförordningar

40

 

9.2

Förslaget till lag om ändring i lagen (1970:417) om

 

 

. ....................................................

marknadsdomstol m.m

45

 

9.3

Förslaget till lag om ändring i lagen (1992:1672) om

 

 

.........................................................................

paketresor

46

 

9.4

Förslaget till lag om ändring i järnvägslagen

 

 

........................................................................

(2004:519)

47

 

9.5

Förslaget till lag om ändring i marknadsföringslagen

48

 

........................................................................

(2008:486)

 

9.6

Förslaget till lag om ändring i lagen (2010:510) om

 

 

...................................................................

lufttransporter

49

 

9.7

Övriga lagförslag med anknytning till tåg - , fartygs -

 

 

...................................

och busspassagerarförordningarna

51

2

Bilaga 1

Europaparlamentets och rådets förordning (EG) nr

 

 

1371/2007 av den 23 oktober 2007 om rättigheter och

 

 

skyldigheter för tågresenärer

 

 

(tågpassagerarförordningen) ................................................

52

Bilaga 2

Europaparlamentets och rådets förordning (EU) nr

 

 

1177/2010 av den 24 november 2010 om passagerares

 

 

rättigheter vid resor till sjöss och på inre vattenvägar

 

 

och om ändring av förordning (EG) nr 2006/2004

 

 

(fartygspassagerarförordningen) ..........................................

80

Bilaga 3

Europaparlamentets och rådets förordning (EU) nr

 

 

181/2011 av den 16 februari 2011 om passagerares

 

 

rättigheter vid busstransport och om ändring av

 

 

förordning (EG) nr 2006/2004

 

 

(busspassagerarförordningen) ..............................................

96

Bilaga 4

Europaparlamentets och rådets förordning (EG) nr

 

 

1008/2008 av den 24 september 2008 om gemensamma

 

 

regler för tillhandahållande av lufttrafik i gemenskapen

 

 

(omarbetning).....................................................................

108

Bilaga 5

Sammanfattning av departementspromemorian Lag om

 

 

resenärers rättigheter – kompletterande bestämmelser

 

 

(Ds 2013:44) ......................................................................

126

Bilaga 6

Promemorians lagförslag ...................................................

128

Bilaga 7

Förteckning över remissinstanser (promemorian)..............

145

Bilaga 8

Förteckning över remissinstanser (förslag till

 

 

författningstext) .................................................................

146

Bilaga 9

Lagrådsremissens lagförslag ..............................................

147

Bilaga 10

Lagrådets yttrande..............................................................

162

Utdrag ur protokoll vid regeringssammanträde den 5 juni 2014..........

165

Rättsdatablad........................................................................................

166

Prop. 2013/14:239

3

Prop. 2013/14:239 1

Förslag till riksdagsbeslut

Regeringen föreslår att riksdagen antar regeringens förslag till

1.lag med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar,

2.lag om ändring i lagen (1970:417) om marknadsdomstol m.m.,

3.lag om ändring i lagen (1992:1672) om paketresor,

4.lag om ändring i järnvägslagen (2004:519),

5.lag om ändring i marknadsföringslagen (2008:486),

6.lag om ändring i lagen (2010:510) om lufttransporter,

7.lag om ändring i järnvägstrafiklagen (1985:192),

8.lag om ändring i lagen (1985:193) om internationell järnvägstrafik,

9.lag om ändring i sjölagen (1994:1009),

10.lag om ändring i lagen (2006:1116) om information till passagerare

m.m.

4

2

Lagtext

Prop. 2013/14:239

Regeringen har följande förslag till lagtext.

2.1Förslag till lag med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar

Härigenom föreskrivs följande.

Tåg-, fartygs- och busspassagerarförordningarna 1 § I denna lag finns bestämmelser som kompletterar

1.Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer (tågpassagerarförordningen),

2.Europaparlamentets och rådets förordning (EU) nr 1177/2010 av den 24 november 2010 om passagerares rättigheter vid resor till sjöss och på inre vattenvägar och om ändring av förordning (EG) nr 2006/2004 (fartygspassagerarförordningen), och

3.Europaparlamentets och rådets förordning (EU) nr 181/2011 av den 16 februari 2011 om passagerares rättigheter vid busstransport och om ändring av förordning (EG) nr 2006/2004 (busspassagerarförordningen).

Tillsyn över att förordningarna följs

2 § Den eller de myndigheter som regeringen bestämmer utövar tillsyn över att de skyldigheter som följer av tåg-, fartygs- och busspassagerar- förordningarna fullgörs.

3 § Regeringen eller den myndighet som regeringen bestämmer får med- dela föreskrifter om avgifter för tillsyn enligt tåg-, fartygs- och buss- passagerarförordningarna.

Sanktioner

4 § Skyldighet att lämna information föreskrivs för järnvägsföretag, biljettutfärdare, stationsförvaltare, researrangörer, transportörer, rese- byråer, terminaloperatörer och hamnmyndigheter i

1.artiklarna 4, 8, 9.5, 18.1, 20, 22.3, 28.2 och 29 i tågpassagerarför- ordningen,

2.artiklarna 8.5, 9.2–9.4, 10, 12.3, 13.3, 16, 22 och 23 i fartygs- passagerarförordningen, och

3.artiklarna 10.2, 10.5, 11.2–11.5, 13.2, 14.5, 20, 24 och 25 i buss- passagerarförordningen.

Om information inte lämnas enligt någon av de bestämmelser som anges i första stycket, ska marknadsföringslagen (2008:486) tillämpas, med undantag av 29–36 §§ om marknadsstörningsavgift. Sådan informa- tion ska anses vara väsentlig enligt 10 § tredje stycket den lagen.

5

Prop. 2013/14:239

5 § Andra skyldigheter än att lämna information föreskrivs för järnvägs- företag, biljettutfärdare, stationsförvaltare, researrangörer, transportörer, resebyråer och terminaloperatörer i

1.artiklarna 9.1–9.4, 18.3–18.5, 19, 22.1, 23, 24, 27 och 28 i tågpassagerarförordningen,

2.artiklarna 4, 7–8.4, 9.1, 10–13.2, 15.4 och 24 i fartygspassagerar- förordningen, och

3.artiklarna 4, 8, 9, 10.1, 10.3, 10.4, 11.1, 13–15, 17.3, 26 och 27 i busspassagerarförordningen.

Den som inte fullgör en sådan skyldighet får åläggas att göra det. Åläggandet får förenas med vite. En talan om ett sådant åläggande väcks vid Marknadsdomstolen av Konsumentombudsmannen.

I ett tillsynsärende om en skyldighet som avses i första stycket tillämpas 42–45 §§ marknadsföringslagen (2008:486) och det som i övrigt gäller enligt den lagen vid tillämpning av de bestämmelserna.

6 § I ett fall som inte är av större vikt får Konsumentombudsmannen meddela ett föreläggande om ett sådant åläggande som avses i 5 §. Bestämmelserna i 28 § marknadsföringslagen (2008:486) ska då tillämpas.

7 § Den myndighet som utövar tillsyn över fullgörandet av de skyld- igheter som anges i artiklarna 10.1, 10.2, 10.4, 21 och 26 i tågpassagerar- förordningen, artikel 14 i fartygspassagerarförordningen och artikel 16.1 i busspassagerarförordningen får meddela de förelägganden som behövs för att bestämmelserna ska följas.

Ett sådant föreläggande får förenas med vite.

Befogenhet att utse bussterminaler

8 § Regeringen eller, efter regeringens bestämmande, en statlig myndig- het eller de regionala kollektivtrafikmyndigheter som avses i lagen (2010:1065) om kollektivtrafik får i det enskilda fallet besluta om att utse bussterminaler där assistans för personer med funktionsnedsättning eller nedsatt rörlighet ska tillhandahållas i enlighet med busspassagerarför- ordningen.

Överklagande

9 § Tillsynsmyndighetens beslut om föreläggande enligt 7 § får över- klagas till allmän förvaltningsdomstol. Detsamma gäller ett beslut av en statlig myndighet eller en regional kollektivtrafikmyndighet om att utse en bussterminal enligt 8 §.

Prövningstillstånd krävs vid överklagande till kammarrätten.

Denna lag träder i kraft den 1 januari 2015.

6

2.2

Förslag till lag om ändring i lagen (1970:417)

Prop. 2013/14:239

 

om marknadsdomstol m.m.

 

Härigenom föreskrivs att 1 § lagen (1970:417) om marknadsdomstol

 

m.m.1 ska ha följande lydelse.

 

 

Nuvarande lydelse

Föreslagen lydelse

 

1 §2 Marknadsdomstolen handlägger mål och ärenden enligt

1.konkurrenslagen (2008:579),

2.marknadsföringslagen (2008:486),

3.lagen (1994:1512) om avtalsvillkor i konsumentförhållanden,

4.lagen (1984:292) om avtalsvillkor mellan näringsidkare,

5.lagen (2000:1175) om talerätt för vissa utländska konsument- myndigheter och konsumentorganisationer,

6.försäkringsavtalslagen (2005:104),

7.lagen (2005:590) om insyn i vissa finansiella förbindelser m.m.,

8.lagen (2006:484) om franchisegivares informationsskyldighet,

9.lagen (2010:510) om lufttransporter,

10.lagen (1986:436) om näringsförbud, och

11.lagen (2010:1350) om upp- giftsskyldighet i fråga om mark- nads- och konkurrensförhållanden.

Bestämmelserna i 14–22 §§ tillämpas inte i mål eller ärenden enligt konkurrenslagen, marknads- föringslagen, försäkringsavtals- lagen, lagen om insyn i vissa finansiella förbindelser m.m., lagen om franchisegivares informationsskyldighet, lagen om lufttransporter, lagen om näringsförbud eller lagen om uppgiftsskyldighet i fråga om marknads- och konkurrensförhåll- anden. I mål enligt mark- nadsföringslagen, försäkrings- avtalslagen eller lagen om franchisegivares informations-

10.lagen (1986:436) om näringsförbud,

11.lagen (2010:1350) om uppgiftsskyldighet i fråga om marknads- och konkurrens- förhållanden, och

12.lagen (2014:000) med

kompletterande bestämmelser till EU:s tåg-, fartygs- och buss- passagerarförordningar.

Bestämmelserna i 14–22 §§ tillämpas inte i mål eller ärenden enligt konkurrenslagen, marknads- föringslagen, försäkringsavtals- lagen, lagen om insyn i vissa finansiella förbindelser m.m., lagen om franchisegivares informationsskyldighet, 13 eller 15 § lagen om lufttransporter, lagen om näringsförbud, lagen om uppgiftsskyldighet i fråga om marknads- och konkurrens- förhållanden eller 4 § lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och buss- passagerarförordningar. I mål

1Lagen omtryckt 1984:294.

2Senaste lydelse 2010:1352.

7

Prop. 2013/14:239 skyldighet tillämpas

inte heller

enligt marknadsföringslagen, för-

13 a §. I stället gäller

rättegångs-

säkringsavtalslagen eller lagen om

reglerna i dessa lagar.

 

franchisegivares

informations-

 

 

skyldighet tillämpas

inte heller

 

 

13 a §. I stället

gäller

rättegångs-

 

 

reglerna i dessa lagar.

 

Denna lag träder i kraft den 1 januari 2015.

8

2.3

Förslag till lag om ändring i lagen (1992:1672) Prop. 2013/14:239

 

om paketresor

 

 

 

 

 

 

 

Härigenom föreskrivs att 18 § lagen (1992:1672) om paketresor ska ha

följande lydelse.

 

 

 

 

 

 

 

 

 

Nuvarande lydelse

 

 

 

Föreslagen lydelse

 

 

 

 

 

 

 

 

18 §1

 

 

 

 

 

Skador

som

omfattas

av

Vissa skador, som omfattas av

bestämmelserna

i

sjölagen

andra bestämmelser, ersätts enligt

(1994:1009),

rådets

förordning

de bestämmelserna i stället för

(EG) nr 2027/97 av den 9 oktober

enligt denna lag. Detta gäller

1997 om lufttrafikföretags skade-

skador som omfattas av bestämm-

ståndsansvar avseende

lufttrans-

elserna i

 

 

 

 

port av passagerare och deras

1. sjölagen (1994:1009),

 

bagage,

lagen

(2010:510)

om

2. rådets

förordning

(EG)

nr

lufttransporter, järnvägstrafiklagen

2027/97 av den 9 oktober 1997 om

(1985:192) eller lagen (1985:193)

lufttrafikföretags

skadestånds-

om internationell

järnvägstrafik

ansvar

avseende

lufttransport

av

ersätts enligt de bestämmelserna i

passagerare och deras bagage,

 

stället för enligt denna lag.

3. lagen

(2010:510)

om luft-

Arrangören är dock alltid skyldig

transporter,

 

 

 

 

att ersätta resenären för vad

4. Europaparlamentets

och

denne har rätt att fordra enligt de

rådets

förordning

(EG)

nr

nämnda bestämmelserna.

 

1371/2007 av den 23 oktober 2007

 

 

 

 

 

 

om rättigheter och skyldigheter för

 

 

 

 

 

 

tågresenärer,

 

 

 

5.järnvägstrafiklagen (1985:192), eller

6.lagen (1985:193) om internationell järnvägstrafik.

Arrangören är dock alltid skyldig att ersätta resenären för vad denne har rätt att fordra enligt de nämnda bestämmelserna.

Denna lag träder i kraft den 1 januari 2015.

1 Senaste lydelse 2010:514.

9

Prop. 2013/14:239

10

2.4Förslag till lag om ändring i järnvägslagen (2004:519)

Härigenom föreskrivs att 1 kap. 2 § och 8 kap. 11 § järnvägslagen (2004:519) ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

1kap.

2 §

Särskilda bestämmelser om befordran av passagerare och gods finns i järnvägstrafiklagen (1985:192) och i lagen (1985:193) om internationell järnvägstrafik.

Särskilda bestämmelser om befordran av passagerare finns i Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättig- heter och skyldigheter för tågrese- närer. Dessutom finns särskilda bestämmelser om befordran av passagerare och gods i järnvägstra- fiklagen (1985:192) och i lagen (1985:193) om internationell järnvägstrafik.

8 kap.

11 §1

Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om avgifter för tillsyn, registrering och ärende- handläggning enligt denna lag, enligt föreskrifter som har meddel- ats med stöd av lagen samt enligt

Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättig- heter och skyldigheter för tågrese- närer, Kommissionens förordning (EG) nr 62/2006 av den 23 december 2005 om teknisk specifikation för driftskompati- bilitet (TSD) avseende delsystemet ”Telematikapplikationer för gods- trafik” i det transeuropeiska järn- vägssystemet för konventionella tåg och Kommissionens förordning

1 Senaste lydelse 2010:1568.

Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om avgifter för tillsyn, registrering och ärende- handläggning enligt denna lag, enligt föreskrifter som har meddel- ats med stöd av lagen samt enligt kommissionens förordning (EG) nr 62/2006 av den 23 december 2005 om teknisk specifikation för driftskompatibilitet (TSD) av- seende delsystemet ”Telematik- applikationer för godstrafik” i det transeuropeiska järnvägssystemet för konventionella tåg och kommissionens förordning (EG) nr 352/2009 av den 24 april 2009 om antagande av en gemensam säkerhetsmetod för riskvärdering och riskbedömning som avses i

(EG) nr 352/2009 av den 24 april

2009 om antagande av en gemensam säkerhetsmetod för riskvärdering och riskbedömning som avses i artikel 6.3 a i Europa- parlamentets och rådets direktiv 2004/49/EG.

artikel 6.3 a i Europaparlamentets Prop. 2013/14:239 och rådets direktiv 2004/49/EG.

Denna lag träder i kraft den 1 januari 2015.

11

Prop. 2013/14:239 2.5

Förslag till lag om ändring i

 

marknadsföringslagen (2008:486)

Härigenom föreskrivs att 1 § marknadsföringslagen (2008:486) ska ha följande lydelse.

Lydelse enligt SFS 2014:16

Föreslagen lydelse

1 §

Denna lag har till syfte att främja konsumenternas och näringslivets intressen i samband med marknadsföring av produkter och att motverka marknadsföring som är otillbörlig mot konsumenter och näringsidkare.

Bestämmelser om marknadsföring finns bl.a. i

lagen (1992:1672) om paketresor,

tobakslagen (1993:581),

lagen (1995:1571) om insättningsgaranti,

lagen (1996:1006) om anmälningsplikt avseende viss finansiell verksamhet,

lagen (1996:1118) om marknadsföring av kristallglas,

lagen (1999:268) om betalningsöverföringar inom Europeiska ekonomiska samarbetsområdet,

lagen (1999:158) om investerarskydd,

lagen (2002:562) om elektronisk handel och andra informationssamhällets tjänster,

lagen (2004:299) om inlåningsverksamhet,

prisinformationslagen (2004:347),

lagen (2005:59) om distansavtal och avtal utanför affärslokaler,

försäkringsavtalslagen (2005:104),

lagen (2005:405) om försäkringsförmedling,

lagen (2006:484) om franchisegivares informationsskyldighet,

lagen (2010:510) om lufttransporter,

radio- och tv-lagen (2010:696),

alkohollagen (2010:1622),

konsumentkreditlagen (2010:1846),

– lagen

(2011:914)

om

– lagen

(2011:914)

om

konsumentskydd

vid

avtal

om

konsumentskydd

vid

avtal

om

tidsdelat

boende

eller

långfristig

tidsdelat

boende

eller

långfristig

semesterprodukt, och

 

 

semesterprodukt,

 

 

 

– lagen

(2013:1054)

om

– lagen

(2013:1054)

om

marknadsföring av modersmjölks-

marknadsföring av modersmjölks-

ersättning och tillskottsnäring.

 

ersättning och tillskottsnäring, och

 

 

 

 

 

lagen

(2014:000)

med

 

 

 

 

 

kompletterande bestämmelser

till

 

 

 

 

 

EU:s tåg-, fartygs- och buss-

 

 

 

 

 

passagerarförordningar.

 

Denna lag träder i kraft den 1 januari 2015.

12

2.6

Förslag till lag om ändring i lagen (2010:510)

Prop. 2013/14:239

 

om lufttransporter

 

Härigenom föreskrivs att 14–17 §§ samt rubriken närmast före 14 § lagen (2010:510) om lufttransporter ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

Bestämmelser i anledning av

Bestämmelser med anledning av

förordning (EG) nr 261/2004,

förordning (EG) nr 261/2004,

förordning (EG) nr 2111/2005

förordning (EG) nr 2111/2005,

och förordning (EG) nr

förordning (EG) nr 1107/2006

1107/2006

och förordning (EG) nr

 

1008/2008

Konsumentverket ska utöva tillsyn över

1. att lufttrafikföretag fullgör de skyldigheter som följer av förordning (EG) nr 261/2004,

14 §

Konsumentverket ska utöva tillsyn över att lufttrafikföretag, deras agenter, researrangörer och biljettförsäljare fullgör de skyldigheter som följer av

1. förordning (EG) nr 261/2004,

2. att lufttrafikföretag, rese- arrangörer och biljettförsäljare fullgör de skyldigheter som följer av artiklarna 11 och 12 i för- ordning (EG) nr 2111/2005, samt

2. artiklarna 11 och 12 i för- ordning (EG) nr 2111/2005,

3. att

lufttrafikföretag,

deras

3. artiklarna 3 och 4 i förordning

agenter och researrangörer full-

(EG) nr 1107/2006, och

gör de skyldigheter som följer av

 

 

artiklarna 3 och 4 i förordning

 

 

(EG) nr 1107/2006.

 

 

 

4. artikel 23 i förordning (EG)

 

 

 

 

 

 

 

 

 

 

 

 

nr 1008/2008.

 

 

 

 

 

 

 

15 §

 

Ett

åläggande

att

 

lämna

Skyldighet att lämna information

föreskriven

information

får

föreskrivs för

lufttrafikföretag,

meddelas

 

 

 

 

deras agenter, researrangörer och

1. ett

lufttrafikföretag

som inte

biljettförsäljare i

 

lämnar

information

 

enligt

1. artikel 14 i förordning (EG)

artikel 14 i

förordning

(EG) nr

nr 261/2004,

 

261/2004,

 

 

 

 

2. artikel 11 i förordning (EG)

2. ett

lufttrafikföretag,

en

nr 2111/2005,

 

researrangör

eller

en

biljettför-

3. artiklarna

4.3 och 4.4 i

13

Prop. 2013/14:239 säljare som inte lämnar in- formation till passagerare enligt artikel 11 i förordning (EG) nr 2111/2005, och

3. ett lufttrafikföretag, dess agent eller en researrangör som inte lämnar information enligt artikel 4 i förordning (EG) nr 1107/2006.

Talan om åläggande enligt första stycket väcks vid Mark- nadsdomstolen. En sådan talan får väckas av

1.Konsumentombudsmannen,

2.en näringsidkare som har ingått ett avtal som rör transport med lufttrafikföretaget, dess agent, researrangören eller biljett- försäljaren, och

3.en sammanslutning av konsumenter eller näringsidkare.

I ett sådant mål gäller i övrigt de bestämmelser i marknads- föringslagen (2008:486) som är tillämpliga i mål om åläggande att lämna information enligt 24 § den lagen.

Ett lufttrafikföretag, dess agent eller en researrangör som vägrar personer med funktionshinder eller nedsatt rörlighet transport i strid med artiklarna 3 och 4 i förord- ningen (EG) nr 1107/2006 får åläggas att vid vite erbjuda transporterna i fråga.

Talan om åläggande enligt första stycket väcks vid Mark- nadsdomstolen av Konsument- ombudsmannen.

14

förordning (EG) nr 1107/2006, och

4. artikel 23.1 i förordning (EG) nr 1008/2008.

Om information inte lämnas enligt någon av de bestämmelser som anges i första stycket, ska marknadsföringslagen (2008:486) tillämpas, med undantag av 29– 36 §§ om marknadsstör- ningsavgift. Sådan information ska anses vara väsentlig enligt 10 § tredje stycket den lagen.

16 §

Ett lufttrafikföretag, dess agent eller en researrangör som vägrar personer med funktionsnedsättning eller nedsatt rörlighet transport i strid med artiklarna 3–4.2 i förordning (EG) nr 1107/2006 får åläggas att erbjuda transporterna i fråga. Åläggandet får förenas med vite.

Ett lufttrafikföretag, dess agent eller en researrangör som erbjuder priser på ett diskriminer- ande sätt i strid med artikel 23.2 i förordning (EG) nr 1008/2008 får förbjudas att göra det. Förbudet får förenas med vite.

Talan om åläggande enligt första stycket och förbud enligt andra stycket väcks vid Mark- nadsdomstolen av Konsument- ombudsmannen.

17 §

I fall som inte är av större vikt får Konsumentombudsmannen meddela föreläggande om sådant åläggande som avses i 15 §.

För ett föreläggande enligt första stycket gäller vad som sägs i 28 § marknadsföringslagen (2008:486).

I ett fall som inte är av större vikt får Konsumentombuds- mannen meddela ett föreläggande om ett sådant åläggande eller förbud som avses i 16 §. Bestämm- elserna i 28 § marknadsförings- lagen (2008:486) ska då tillämpas.

Denna lag träder i kraft den 1 januari 2015.

Prop. 2013/14:239

15

Prop. 2013/14:239 2.7

Förslag till lag om ändring i järnvägstrafiklagen

 

(1985:192)

Härigenom föreskrivs att det i järnvägstrafiklagen (1985:192) ska införas en ny paragraf, 1 kap. 1 a §, av följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 kap.

1 a §

Särskilda bestämmelser om be- fordran av passagerare finns i Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättig- heter och skyldigheter för tågrese- närer.

Denna lag träder i kraft den 1 januari 2015.

16

2.8

Förslag till lag om ändring i lagen (1985:193)

Prop. 2013/14:239

 

om internationell järnvägstrafik

 

Härigenom föreskrivs att det i lagen (1985:193) om internationell

 

järnvägstrafik ska införas en ny paragraf, 1 a §, av följande lydelse.

 

Nuvarande lydelse

Föreslagen lydelse

 

 

 

1 a §

 

Särskilda bestämmelser om be- fordran av passagerare finns i Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättig- heter och skyldigheter för tågrese- närer.

Denna lag träder i kraft den 1 januari 2015.

17

Prop. 2013/14:239 2.9

Förslag till lag om ändring i sjölagen

 

(1994:1009)

Härigenom föreskrivs att det i sjölagen (1994:1009) ska införas en ny paragraf, 15 kap. 1 a §, av följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

15 kap.

1 a §

Särskilda bestämmelser om befordran av passagerare finns i Europaparlamentets och rådets förordning (EU) nr 1177/2010 av den 24 november 2010 om passagerares rättigheter vid resor till sjöss och på inre vattenvägar och om ändring av förordning (EG) nr 2006/2004.

Denna lag träder i kraft den 1 januari 2015.

18

2.10

Förslag till lag om ändring i lagen (2006:1116) Prop. 2013/14:239

 

om information till passagerare m.m.

Härigenom föreskrivs att det i lagen (2006:1116) om information till passagerare m.m. ska införas en ny paragraf, 1 a §, av följande lydelse.

Nuvarande lydelse Föreslagen lydelse

1 a §

Särskilda bestämmelser om ersättning och information till passagerare finns i Europaparla- mentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer och i Europaparlamentets och rådets förordning (EU) nr 181/2011 av den 16 februari 2011 om passagerares rättigheter vid buss- transport och om ändring av förordning (EG) nr 2006/2004.

Denna lag träder i kraft den 1 januari 2015.

19

Prop. 2013/14:239 3

Ärendet och dess beredning

 

Inom EU har det bedrivits ett omfattande arbete med att stärka resenärers

 

rättigheter.

 

 

Tidigare har det antagits två förordningar på luftfartsområdet. Den ena

 

är Europaparlamentets och rådets förordning (EG) nr 261/2004 av den 11

 

februari 2004 om fastställande av gemensamma regler om kompensation

 

och assistans till passagerare vid nekad ombordstigning och inställda

 

eller kraftigt försenade flygningar och om upphävande av förordning

 

(EEG) nr 295/91 (förordningen om nekad ombordstigning). Den andra är

 

Europaparlamentets och rådets förordning (EG) nr 1107/2006 av den 5

 

juli 2006 om rättigheter i samband med flygresor för personer med

 

funktionshinder och personer med nedsatt rörlighet.

 

Sedan 2007 har det antagits ytterligare tre förordningar om resenärers

 

rättigheter vid tåg-, fartygs- och busstransporter:

 

– Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den

 

23 oktober 2007 om rättigheter och skyldigheter för tågresenärer

 

(tågpassagerarförordningen),

 

– Europaparlamentets och rådets förordning (EU) nr 1177/2010 av den

 

24 november 2010 om passagerares rättigheter vid resor till sjöss och på

 

inre vattenvägar och om ändring av förordning (EG) nr 2006/2004

 

(fartygspassagerarförordningen), och

 

– Europaparlamentets och rådets förordning (EU) nr 181/2011 av den

 

16 februari 2011 om passagerares rättigheter vid busstransport och om

 

ändring av förordning (EG) nr 2006/2004 (busspassagerarförordningen).

 

Tågpassagerarförordningen tillämpas sedan den 3 december 2009,

 

fartygspassagerarförordningen sedan den 18 december 2012 och buss-

 

passagerarförordningen sedan den 1 mars 2013. Förordningarna finns

 

som bilaga 1–3.

 

Regeringen utsåg genom förordningen (2012:772) om behöriga

 

myndigheter för resenärers rättigheter Konsumentverket och Transport-

 

styrelsen till tillsynsmyndigheter för tåg-, fartygs- och busspassagerar-

 

förordningarna.

 

De tre EU-förordningarna gör det nödvändigt att komplettera svensk

 

lagstiftning i några avseenden. Det handlar i första hand om att

 

sanktioner ska finnas att tillgå för det fall skyldigheterna enligt förordn-

 

ingarna inte följs. Förslag till sådana sanktioner lämnas i den inom

 

Justitiedepartementet utarbetade departementspromemorian Lag om res-

 

enärers rättigheter – kompletterande bestämmelser (Ds 2013:44).

 

I promemorian föreslås också bestämmelser om sanktioner som kom-

 

pletterar Europaparlamentets och rådets förordning (EG) nr 1008/2008 av

 

den 24 september 2008 om gemensamma regler för tillhandahållande av

 

lufttrafik i gemenskapen (omarbetning). Förordningen finns som

 

bilaga 4. Vidare föreslås i promemorian en ändring av den sanktion som

 

gäller vid överträdelser av informationsskyldigheter i tre andra EU-för-

 

ordningar på luftfartens område.

 

En sammanfattning av promemorian finns i bilaga 5. Promemorians

 

lagförslag finns i bilaga 6.

 

Promemorian har remissbehandlats. En förteckning över remiss-

20

instanserna

finns i bilaga 7. Det har också skett en kompletterande

 

 

remittering av förslag till författningstext. En förteckning över remiss-

Prop. 2013/14:239

instanserna i den kompletterande remissbehandlingen finns i bilaga 8.

 

Remissvaren finns tillgängliga i Justitiedepartementet (dnr Ju2013/4865/L3 och Ju2014/2716/L3).

I promemorian finns också förslag som inte är nödvändiga för att uppfylla EU-rättens krav. Förslagen syftar till att möjliggöra förslagen i betänkandet Lag om resenärers rättigheter i lokal och regional kollektiv- trafik (SOU 2009:81) genom att undanta viss tågtrafik från tillämpningen av vissa bestämmelser i tågpassagerarförordningen. Förslagen i promem- orian kompletterar också betänkandets förslag. Regeringens avsikt var att lämna ett samlat förslag i de frågor som omfattas av betänkandet och promemorian. Mot bakgrund av att Europeiska kommissionen har inlett ett överträdelseärende mot Sverige angående bristande uppfyllelse av busspassagerarförordningen omfattar dock denna proposition endast de förslag som bedöms nödvändiga för att uppfylla förordningarnas krav. Regeringen avser att återkomma med förslag i övriga frågor.

Lagrådet

Regeringen beslutade den 15 maj 2014 att inhämta Lagrådets yttrande över de förslag som finns i bilaga 9.

Lagrådets yttrande finns i bilaga 10. Lagrådet rekommenderar på en punkt att ytterligare överväganden görs och på en annan punkt att vissa frågor belyses ytterligare. Lagrådets synpunkter behandlas i avsnitt 4 och 5 samt i författningskommentaren.

I förhållande till lagrådsremissens lagförslag görs dessutom ett par redaktionella ändringar.

4Tåg-, fartygs- och busspassagerar- förordningarna

Förordningarnas huvudsakliga innehåll

Ett gemensamt syfte med tåg-, fartygs- och busspassagerarförordn- ingarna är att garantera resenärer vissa rättigheter. Förordningarna har stora inbördes likheter. Exempelvis innehåller alla tre förordningarna likartade bestämmelser om rätt till ersättning och information vid försen- ingar och inställda avgångar. En central del i förordningarna är de rättig- heter som tillkommer personer med funktionsnedsättning eller nedsatt rörlighet. Dessutom innehåller förordningarna skyldigheter för medlems- staterna att tillhandahålla sanktioner vid överträdelser av förordningarnas bestämmelser och att utse tillsynsorgan. Förordningarna utgör tvingande minimiregleringar till resenärernas förmån, dvs. rättigheterna får inte begränsas eller åsidosättas genom avtal (artikel 6 i respektive förordn- ing).

Passagerarförordningarna innehåller några möjligheter till undantag när det gäller tillämpningsområdet. Regeringen avser att återkomma i frågan om undantag i samband med att regeringen lägger fram förslag i

21

Prop. 2013/14:239 övriga frågor som omfattas av betänkandet och promemorian (se av- snitt 3).

Tågpassagerarförordningen

Tågpassagerarförordningen är tillämplig på alla tågresor och järnvägs- tjänster inom EU. Undantag görs dock för transporter som inte tillhanda- hålls med tillstånd enligt rådets direktiv 95/18/EG av den 19 juni 1995 om tillstånd för järnvägsföretag (direktivet har senare ersatts av direktiv 2012/34/EU). Det innebär bl.a. att järnvägsföretag som enbart tillhanda- håller tjänster som avser persontrafik på lokal och regional fristående järnvägsinfrastruktur utan förbindelse med det allmänna nätet inte om- fattas av förordningen.

Delar av fördraget om internationell järnvägstrafik (COTIF) av den 9 maj 1980, i dess lydelse enligt ändringsprotokollet av den 3 juni 1999, har införlivats med tågpassagerarförordningen. Det gäller huvuddelen av de enhetliga rättsreglerna för avtal om internationell transport av resande på järnväg (CIV), vilka är intagna som bilaga 1 till förordningen.

CIV ligger bl.a. till grund för förordningens bestämmelser om transportavtal, information och biljetter, som finns i andra kapitlet. Här finns också bestämmelser om bl.a. information om trafikutbud och rese- information som ska lämnas till resenärer (artiklarna 7 och 8) och hur järnvägsföretag och biljettutfärdare ska tillhandahålla biljetter (artikel 9).

I kapitel tre finns bestämmelser om skadeståndsansvar för järnvägs- företag om resenärer dör eller skadas eller om resgods går förlorat eller skadas (artikel 11). Med järnvägsföretag avses i förordningen ett företag som tillhandahåller dragkraft, dvs. fysiskt utför själva transporten, vid person- eller godstransporter (se artikel 3.1 och prop. 2003/04:123 s. 170). Regleringen bygger på de ansvarsbestämmelser som finns i CIV. Utgångspunkten är att ett järnvägsföretag ansvarar för dödsfall och skador som drabbar en resenär och för skada på eller förlust av hand- resgods som resenären medförde när han eller hon dog eller skadades. Härutöver innehåller förordningen kompletterande bestämmelser om bl.a. rätt till förskottsbetalning av ersättning till resenären eller dennes efter- levande (artikel 13), skyldighet för järnvägsföretaget att hjälpa en resenär som begär skadestånd från tredje part (artikel 14) och skyldighet för järnvägsföretag att ha en ansvarsförsäkring som täcker skadestånds- ansvaret enligt förordningen (artikel 12). Dessutom finns en närliggande bestämmelse i kapitel fem som förbjuder en beloppsmässig begränsning vid skadeståndsskyldighet för förlust av eller skada på rörlighetshjälp- medel (artikel 25).

Kapitel fyra innehåller bestämmelser om järnvägsföretagens ansvar vid förseningar, inställda avgångar och uteblivna anslutningar. Även i denna del bygger regleringen (artikel 15) på bestämmelserna i CIV. Huvud- regeln är att ett järnvägsföretag är ansvarigt för skada som uppkommer på grund av att en tåginställelse, försening eller utebliven anslutning medför att en resa inte kan fortsätta samma dag. Ersättningen ska täcka rimliga kostnader för kost och logi samt kostnader för att underrätta personer som väntar på den resande. Dröjsmålsansvaret byggs sedan ut genom kompletterande bestämmelser om ersättning och ombokning vid

befarade eller konstaterade förseningar (artiklarna 16 och 17). Vidare är

22

järnvägsföretag och stationsförvaltare skyldiga att vid en försenad avgång eller ankomst hålla resenärerna informerade om situationen och förväntade avgångs- och ankomsttider samt, under vissa närmare be- skrivna omständigheter, tillhandahålla olika former av assistans (artikel 18). Förordningens bestämmelser hindrar inte en resenär från att i enlig- het med nationell lagstiftning begära ersättning för annan skada med anledning av en inställd eller försenad transporttjänst än sådan som täcks av förordningen (artikel 32.3 i bilaga 1).

I kapitel fem finns särskilda bestämmelser som rör personer med funktionsnedsättning eller nedsatt rörlighet. Dessa får som huvudregel inte nekas att boka eller köpa biljetter på grund av funktionsned- sättningen (eller den nedsatta rörligheten). Inte heller får det krävas att de åtföljs av en annan person. Det finns dock möjlighet att göra undantag, om det är nödvändigt för att uppfylla sådana icke-diskriminerande regler för befordran av personer med funktionsnedsättning som järnvägsföretag och stationsförvaltare enligt förordningen är skyldiga att fastställa. Reglerna ska tas fram i samarbete med organisationer som företräder personer med funktionsnedsättning (artikel 19). Järnvägsföretag, biljett- utfärdare och researrangörer ska på begäran informera personer med funktionsnedsättning om tillgänglighet m.m. (artikel 20). Vidare ska stationsförvaltare och järnvägsföretag tillhandahålla kostnadsfri assistans så att personer med funktionsnedsättning kan stiga på och av tåg samt byta till anslutande tåg (artiklarna 22 och 23). Järnvägsföretagen ska dessutom lämna assistans ombord på tågen. De närmare förutsättningarna och villkoren för assistansen anges i artikel 24, bl.a. att behovet av assistans ska ha meddelats 48 timmar i förväg. Även om detta inte har skett, måste järnvägsföretaget och stationsförvaltaren i rimlig utsträck- ning lämna den assistans som behövs för att personen i fråga ska kunna resa. Stationer, perronger, rullande materiel samt andra inrättningar ska anpassas så att de är tillgängliga för personer med funktionsnedsättning i enlighet med de tekniska specifikationerna för driftskompatibilitet (TSD) för personer med nedsatt rörlighet (artikel 21).

I kapitel sex behandlas frågor om säkerhet, klagomål och tjänstekval- itet. Järnvägsföretag, infrastrukturförvaltare och stationsförvaltare ska i samförstånd med de offentliga myndigheterna arbeta för att säkerställa resenärernas personliga säkerhet på järnvägsstationer och ombord på tågen (artikel 26). Järnvägsföretagen ska även inrätta ett system för att hantera klagomål från resenärerna (artikel 27), fastställa kvalitetsnormer för verksamheten och införa ett system för kvalitetsstyrning (artikel 28).

I förordningens sjunde och åttonde kapitel finns bestämmelser om information och om kontroll av efterlevnaden av förordningens be- stämmelser. Järnvägsföretag, stationsförvaltare och researrangörer ska, när de säljer biljetter, informera resenärerna om deras rättigheter enligt förordningen (artikel 29). Varje medlemsstat ska utse ett eller flera oberoende tillsynsorgan som ska ansvara för att förordningen följs (artikel 30). Medlemsstaterna ska även införa sanktioner vid överträd- elser av bestämmelserna i förordningen (artikel 32).

På grund av EU-rättens företräde tillämpas tågpassagerarförordningen i stället för motsvarande bestämmelser i lagen (1985:193) om inter- nationell järnvägstrafik och järnvägstrafiklagen (1985:192). Vidare innebär lagen om internationell järnvägstrafik att en äldre version av CIV

Prop. 2013/14:239

23

Prop. 2013/14:239 tillämpas vid vissa internationella transporter som faller utanför tågpassagerarförordningens tillämpningsområde. Det är olika domstolar som ytterst har att uttolka innebörden av de olika versionerna av CIV; EU-domstolen i förhållande till tågpassagerarförordningen och Högsta domstolen i förhållande till lagen om internationell järnvägstrafik. Lagrådet anser att det finns skäl att i det fortsatta lagstiftningsarbetet något belysa den inskränkning av tillämpningsområdet för lagen om internationell järnvägstrafik som förordningen innebär och om tolk- ningen av de olika CIV-versionerna kan komma att utvecklas på skilda sätt.

Frågorna har direkt koppling till Järnvägstrafikutredningens uppdrag. Utredningen föreslår i ett delbetänkande (SOU 2014:26) att Sverige ska tillträda den senaste versionen av COTIF (inklusive CIV) och de lagändringar som behövs vid ett tillträde. Det föreslås bl.a. ändringar i lagen om internationell järnvägstrafik för att lagen ska uppfylla kraven i COTIF och samtidigt beakta tågpassagerarförordningen. CIV föreslås bli gällande som svensk lag. I ett andra steg ska utredningen bl.a. göra en översyn av lagstiftningen om inrikes transporter och föreslå ändringar för att uppnå ett modernt regelverk (dir. 2013:79). Mot denna bakgrund är det lämpligt att en ytterligare belysning av de frågeställningar som Lagrådet lyfter fram sker i samband med att regeringen lägger fram förslag i anledning av Järnvägstrafikutredningens betänkanden.

Fartygspassagerarförordningen

Fartygspassagerarförordningen tillämpas, som huvudregel, på passager- artransporter till sjöss och på inre vattenvägar där ombordstignings- hamnen är belägen inom en medlemsstats territorium. Förordningen till- lämpas även om landstigningshamnen är belägen inom en medlemsstats territorium och transporten genomförs av en transportör som är etablerad inom unionen. Vidare är förordningen med vissa undantag tillämplig på kryssningar där ombordstigningshamnen är belägen inom en medlems- stats territorium (artikel 2). Med kryssning avses en transport i nöjes- eller rekreationssyfte som innefattar bl.a. mer än två övernattningar ombord på fartyget. Vissa passagerartransporter undantas från förordn- ingens tillämpningsområde, t.ex. sådana som sker med fartyg certifierade för högst 12 personer och andra utflykts- och sightseeingturer än kryss- ningar (artikel 2.2).

Transportören måste utfärda en biljett eller annat färdbevis, om inte andra handlingar ger rätt till transport enligt nationell lagstiftning. De avtalsvillkor som tillämpas får inte vara diskriminerande med hänsyn till kundens nationalitet (artikel 4).

Den som bär ansvar enligt förordningen undgår inte ansvaret genom att uppdra åt någon annan att utföra en skyldighet enligt förordningen, utan blir i sådant fall ansvarig för den utförande partens handlande. Dessutom bär den som uppdraget anförtros åt ansvar enligt förordningens bestämm- elser (artikel 5).

Kapitel två reglerar rättigheter för personer med funktionsnedsättning (eller nedsatt rörlighet). Transportörer, resebyråer och researrangörer får inte vägra att godkänna en bokning, utfärda en biljett eller tillåta ombord-

stigning med hänvisning till en persons funktionsnedsättning (artikel 7).

24

Vissa undantag medges dock med hänvisning till säkerhetskrav eller fartygets eller infrastrukturens utformning (artikel 8.1). Transportören, resebyrån eller researrangören ska i sådana undantagsfall göra alla rim- liga ansträngningar för att erbjuda ett godtagbart transportalternativ (artikel 8.2). Transportörerna och terminaloperatörerna är vidare skyldiga att, i samarbete med organisationer som företräder personer med funkt- ionsnedsättning, fastställa icke-diskriminerande villkor för tillgänglighet för befordran av personer med funktionsnedsättning (artikel 9) och ge kostnadsfri assistans till denna kategori av resenärer i hamnar och om- bord på fartyg. Assistansens omfattning följer av bilagorna 2 och 3 till förordningen (artikel 10). En resenär måste dock uppfylla vissa krav för att ha rätt till assistans, bl.a. måste transportören eller terminaloperatören underrättas om behovet av assistans 48 timmar i förväg (artikel 11). Även om detta inte har skett, ska transportören och terminaloperatören göra alla rimliga ansträngningar för att resenären får den assistans som han eller hon behöver. Transportörerna, och i förekommande fall även terminaloperatörerna, är vidare skyldiga att inrätta ett utbildningsför- farande om funktionsnedsättningar och funktionshinder för sin personal (artikel 14).

Transportörer och terminaloperatörer ansvarar för förlust av och skada på rörelsehjälpmedel, om förlusten eller skadan beror på fel eller försum- lighet från deras respektive sida (artikel 15).

Kapitel tre innehåller bestämmelser om skyldigheter för transportörer och terminaloperatörer vid störningar av resor. Transportören eller, i förekommande fall, terminaloperatören är vid en försenad eller inställd avgång skyldig att hålla resenärerna informerade om läget (artikel 16). Om transportören på skäliga grunder kan anta att en avgång kommer att ställas in eller försenas med mer än 90 minuter, är transportören dess- utom skyldig att tillhandahålla olika former av assistans samt ombokning alternativt återbetalning av biljettpriset (artiklarna 17 och 18). Resen- ärerna har också, under vissa förutsättningar, rätt till en viss lägsta ersätt- ning vid försenad ankomst till slutdestinationen (artikel 19). För rätten till assistans och ersättning gäller vissa undantag, bl.a. om förseningen beror på svåra väderförhållanden (artikel 20). Förordningens bestämm- elser hindrar inte en resenär från att i enlighet med nationell lagstiftning begära skadestånd för förlust med anledning av en inställd eller försenad transporttjänst (artikel 21).

I kapitel fyra finns allmänna bestämmelser om information och klago- mål. Resenärerna har rätt att få adekvat reseinformation under hela resan (artikel 22). Vidare ska transportörerna, terminaloperatörerna och, i före- kommande fall, hamnmyndigheterna se till att information om resen- ärernas rättigheter enligt förordningen görs tillgänglig. I båda fallen ska särskild vikt fästas vid behoven hos personer med funktionsnedsättning (artikel 23). Slutligen ska transportörerna och terminaloperatörerna in- rätta en mekanism för hantering av klagomål avseende rättigheter och skyldigheter som följer av förordningen (artikel 24).

Kapitel fem innehåller regler om efterlevnad och nationella tillsyns- organ. Varje medlemsstat ska utse ett eller flera oberoende organ med ansvar för att se till att förordningen följs vad gäller trafik till och från hamnar inom det egna territoriet (artikel 25). Medlemsstaterna får före- skriva att en resenär, som en första åtgärd, måste vända sig till transport-

Prop. 2013/14:239

25

Prop. 2013/14:239 ören och att den nationella tillsynsmyndigheten ska utgöra överklagande- instans. Medlemsstaterna ska också införa sanktioner vid överträdelser av bestämmelserna i förordningen (artikel 28).

Busspassagerarförordningen

Busspassagerarförordningens tillämpningsområde omfattar linjetrafik för icke specificerade passagerarkategorier med påstignings- eller avstig- ningsplats inom en medlemsstats territorium när transportsträckan enligt tidtabell är minst 250 km (artikel 2.1). Med linjetrafik avses persontrans- porter med buss vid regelbundna tider längs bestämda färdvägar, varvid resenärerna får stiga på och av vid i förväg bestämda hållplatser. Vissa av förordningens bestämmelser är dock tillämpliga även vid linjetrafik när transportsträckan understiger 250 km (artikel 2.2). Det gäller bl.a. rätten till transport för personer med funktionsnedsättning (eller nedsatt rörlighet), skyldigheten att utbilda personal om funktionsnedsättningar och funktionshinder, ansvaret för skada på rörlighetsutrustning och rätten till reseinformation.

Busspassagerarförordningens tillämpningsområde omfattar också till- fällig trafik, om resenärens första påstigningsplats eller slutliga avstig- ningsplats ligger inom en medlemsstats territorium (artikel 2.3). Med tillfällig trafik avses trafik som inte utgör linjetrafik och som huvudsak- ligen kännetecknas av transport med buss av resenärsgrupper som har bildats på initiativ av kunden eller transportören. För sådan trafik gäller dock endast vissa av förordningens bestämmelser, bl.a. bestämmelserna om biljetter och icke-diskriminerande avtalsvillkor, om andra utförande parter samt om ersättning och assistans i händelse av olyckor.

Transportörerna ska utfärda biljetter, om inte andra handlingar ger rätt till transport, och ha avtalsvillkor som inte diskriminerar kunder bero- ende på nationalitet (artikel 4). Den som bär ansvar enligt förordningen kan inte undgå ansvaret genom att uppdra åt någon annan att utföra en skyldighet enligt förordningen. Detta leder i stället till att även den som uppdraget anförtros åt bär ansvar enligt förordningen (artikel 5).

Förordningens andra kapitel reglerar ersättning och assistans vid olyckor. Resenärer ska, i enlighet med nationell lag, ha rätt till ersättning vid dödsfall och personskada i samband med en olycka som inträffar till följd av användning av en buss. Detsamma ska gälla om resgods förlorats eller skadats vid en sådan olycka (artikel 7). Vid olyckor ska transport- örerna också tillhandahålla assistans med syfte att tillgodose resenärernas omedelbara praktiska behov (artikel 8).

Förordningens tredje kapitel rymmer bestämmelser om rättigheter för personer med funktionsnedsättning. Transportörerna och terminal- operatörerna ska, i samråd med organisationer som företräder personer med funktionsnedsättning, fastställa icke-diskriminerande villkor för till- gänglighet som gäller vid transport av personer med funktionsned- sättning. De ska också lämna information om villkoren i en form som lämpar sig för denna resenärskategori (artikel 11). Transportörer, rese- byråer och researrangörer får inte, med vissa angivna undantag, vägra att tillhandahålla bokning eller biljett eller neka en person att stiga ombord på en buss med hänvisning till personens funktionsnedsättning (artiklarna

9 och 10). Undantag får göras endast om det krävs för att uppfylla

26

gällande säkerhetskrav eller om bussens eller infrastrukturens utformning omöjliggör resa.

Medlemsstaterna ska utse bussterminaler där särskild assistans ska tillhandahållas av transportörer och terminaloperatörer utan kostnad (artiklarna 12 och 13.1). Förordningen påverkar dock inte befintlig lag- stiftning om tekniska krav på bussar, hållplatser eller terminaler (artikel 2.7). De närmare förutsättningarna och villkoren för assistansen anges i artikel 14, bl.a. ska behovet av assistans ha meddelats senast 36 timmar i förväg. Även om en sådan underrättelse inte har skett, ska transportören, terminaloperatören, resebyrån och researrangören i rimlig utsträckning lämna den assistans som behövs för att personen ska kunna resa. Trans- portörerna ska dessutom tillhandahålla kostnadsfri assistans ombord på bussarna (artikel 13.2). Transportörerna och, vid behov, terminaloper- atörerna är också skyldiga att inrätta ett förfarande för utbildning av sin personal om funktionshinder och funktionsnedsättningar (artikel 16).

I det fjärde kapitlet finns bestämmelser om resenärernas rättigheter vid inställda resor eller förseningar. Om det på skäliga grunder kan antas uppstå en försening av linjetrafik med mer än 120 minuter från en bemannad terminal eller att avgången kommer att ställas in, ska resen- ärerna få välja mellan fortsatt resa, ombokning eller återbetalning av biljettpriset. Detsamma gäller om avgången faktiskt ställs in eller för- senas med mer än 120 minuter från en busshållplats (artikel 19). Förordningen hindrar inte att en resenär begär skadestånd i enlighet med nationell lagstiftning för skador med anledning av inställd eller försenad linjetrafik (artikel 22). Transportörerna eller terminaloperatörerna är vidare skyldiga att lämna information om förseningar och inställda avgångar samt alternativa anslutningar (artikel 20). Om en resa enligt tidtabell överstiger tre timmar och denna blir inställd eller avgången blir försenad med mer än 90 minuter från en bemannad terminal, ska trans- portören dessutom erbjuda resenärerna förtäring och, om det krävs, inkvartering. Vissa begränsningar och undantag gäller för dessa skyldig- heter (artiklarna 21 och 23).

Kapitel fem innehåller en skyldighet för transportörerna och terminal- operatörerna att lämna dels adekvat reseinformation, dels information om resenärernas rättigheter enligt förordningen (artiklarna 24 och 25). Vidare finns en skyldighet för transportörerna att inrätta en mekanism för hantering av klagomål avseende de rättigheter och skyldigheter som följer av förordningen (artiklarna 26 och 27).

I det sjätte kapitlet åläggs medlemsstaterna att utse ett eller flera organ som ansvarar för att förordningen följs. Resenärer ska kunna lämna klagomål om överträdelser av förordningen till tillsynsmyndigheten. Medlemsstaterna får föreskriva att en resenär, som en första åtgärd, måste vända sig till transportören och att den nationella tillsynsmyndig- heten i sådana fall ska utgöra överklagandeinstans (artikel 28). Medlems- staterna ska också fastställa sanktioner vid överträdelser av bestämm- elserna i förordningen (artikel 31).

Prop. 2013/14:239

27

Prop. 2013/14:239

5

Tillsyn och sanktioner

 

 

 

Regeringens förslag: Det ska införas en ny lag med kompletterande

 

bestämmelser till tåg-, fartygs- och busspassagerarförordningarna.

 

Den nya lagen ska bl.a. innehålla bestämmelser om tillsyn och

 

sanktioner.

 

 

Om information inte lämnas enligt vad som föreskrivs i tåg-,

 

fartygs- eller busspassagerarförordningen, ska sanktioner i marknads-

 

föringslagen användas. Detsamma ska gälla vid överträdelser av

 

informationsskyldigheter enligt vissa EU-förordningar på luftfartens

 

område.

 

 

Det ska införas en särskild marknadsrättslig sanktion som gäller vid

 

överträdelser av andra konsumentskyddande bestämmelser i passag-

 

erarförordningarna, bl.a. bestämmelserna om tillhandahållande av

 

biljetter och bokningar och om assistans till resenärer med funktions-

 

nedsättning. Sanktionen ska innebära att den som inte uppfyller sin

 

skyldighet enligt någon av förordningarna ska kunna åläggas att göra

 

det. Åläggandet ska få förenas med vite. Konsumentombudsmannen

 

ska då ha samma utrednings- och tillsynsbefogenheter som står till

 

buds när marknadsföringslagen är tillämplig. En särskild marknads-

 

rättslig sanktion ska också gälla vid överträdelser av förbudet mot

 

diskriminering vid tillgång till passagerar- och fraktpriser enligt EU-

 

förordningen om gemensamma regler för tillhandahållande av luft-

 

trafik i gemenskapen.

 

 

Ansvarig tillsynsmyndighet ska bemyndigas att meddela de före-

 

lägganden som behövs för efterlevnaden av bestämmelser av teknisk

 

karaktär i tågpassagerarförordningen, bl.a. bestämmelserna om till-

 

gänglighet för resenärer med funktionsnedsättning vid stationer och

 

perronger och om åtgärder för att trygga resenärernas personliga

 

säkerhet. Samma möjlighet för tillsynsmyndigheten ska finnas

 

beträffande skyldigheterna enligt fartygs- och busspassagerarförordn-

 

ingarna att inrätta förfaranden för utbildning av personal om funkt-

 

ionsnedsättningar och funktionshinder. Ett föreläggande ska få förenas

 

med vite. Ett beslut om föreläggande ska kunna överklagas till allmän

 

förvaltningsdomstol. Prövningstillstånd ska krävas vid överklagande

 

till kammarrätten.

 

 

Regeringen eller den myndighet som regeringen bestämmer ska

 

bemyndigas att meddela föreskrifter om avgifter för tillsyn enligt

 

fartygs- och busspassagerarförordningarna.

 

 

Konsumentverkets nuvarande tillsynsansvar rörande EU-förord-

 

ningen om gemensamma regler för tillhandahållande av lufttrafik i

 

gemenskapen ska framgå av lag. Det ska också framgå av lag att till-

 

synsmyndigheter för passagerarförordningarna utses av regeringen.

 

 

Promemorians förslag överensstämmer i huvudsak med regeringens

 

(se promemorian s. 83 f., 107 f., 108 f., 110 f., 113 f., 117 f., 120 f. och

 

123 f.) I promemorian föreslås dock att tillsynsmyndigheten ska

 

bemyndigas att återkalla ett tillstånd för järnvägsföretag att bedriva

 

järnvägstrafik, om tillståndshavaren inte uppfyller sina skyldigheter

28

enligt tågpassagerarförordningens bestämmelser om reseinformation och

bokningssystem, tillgänglighet och resenärernas personliga säkerhet. Prop. 2013/14:239 Vidare finns några andra avvikelser i förhållande till regeringens förslag.

Regeringen föreslår bl.a. att promemorians förslag ska kompletteras med ytterligare några bestämmelser som ska omfattas av en särskild marknadsrättslig sanktion och, till skillnad från promemorian, att Konsumentombudsmannen ska ha vissa utrednings- och tillsynsbefogen- heter.

Remissinstanserna: De flesta remissinstanserna tillstyrker eller har inga invändningar mot förslagen. Transportstyrelsen anser att förslaget om återkallelse av tillstånd att bedriva järnvägstrafik strider mot EU- rätten.

En kompletterande remittering av förslag till författningstext har gjorts till Marknadsdomstolen, Konsumentverket och Transportstyrelsen som i allt väsentligt tillstyrker eller inte har några invändningar mot förslagen.

Skälen för regeringens förslag

En ny lag med kompletterande bestämmelser

Som framgår av avsnitt 4 ska medlemsstaterna ha sanktioner som gäller vid överträdelser av passagerarförordningarnas bestämmelser. I förord- ningarna anges att sanktionerna ska vara effektiva, proportionerliga och avskräckande. Medlemsstaterna ska också utse ett eller flera organ som utövar tillsyn över att förordningarna följs och som kan vidta åtgärder för att säkerställa detta. Resenärerna ska även kunna rikta klagomål om över- trädelser av förordningarna till tillsynsorganet eller till ett annat lämpligt organ.

Som framgår av avsnitt 3 har regeringen uppfyllt skyldigheten att utse tillsynsorgan genom att i förordningen om behöriga myndigheter för resenärers rättigheter utse Konsumentverket och Transportstyrelsen till tillsynsmyndigheter för passagerarförordningarna. Det som återstår för att uppfylla passagerarförordningarnas krav är alltså att fastställa de sanktioner som ska gälla. Dessutom finns det anledning att införa några kompletterande bestämmelser om tillsynen.

Bestämmelser om tillsyn och sanktioner som gäller tåg- och fartygs- passagerarförordningarna skulle kunna tas in i de befintliga lagar som reglerar transportörers ansvar vid passagerartransporter, dvs. järnvägs- trafiklagen och lagen om internationell järnvägstrafik respektive sjölagen (1994:1009). För bussresor finns dock ingen motsvarande lag där det är naturligt att införa sådana bestämmelser som gäller busspassagerar- förordningen. Dessutom finns det skäl som talar för att bestämmelserna bör hållas samlade i en och samma lag. De tre förordningarna utgör delar av ett paket om resenärsrättigheter som innebär likartade rättigheter oavsett vilket av de tre trafikslagen som används. Det finns därför ett intresse av att resenärer kan ta del av bestämmelserna om tillsyn och sanktioner på ett samlat sätt, även om regleringen i första hand riktar sig till myndigheter. Regeringen anser det mot den bakgrunden lämpligt att - bestämmelserna tas in i en ny lag med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar.

29

Prop. 2013/14:239

30

Kompletterande sanktioner till EU-förordningar på luftfartsområdet

I det här sammanhanget är det lämpligt att också ta ställning till sankt- ioner i förhållande till vissa bestämmelser i förordningen om gemen- samma regler för tillhandhållande av lufttrafik i gemenskapen. I artikel 23 i den förordningen finns bestämmelser om prisinformation och godkännande av pristillägg samt om förbud mot diskriminering vid tillgång till passagerarpriser och fraktpriser. På motsvarande sätt som enligt passagerarförordningarna är medlemsstaterna skyldiga att ha sanktioner vid överträdelser av bestämmelserna.

Det finns vidare anledning att överväga den befintliga sanktion i lagen (2010:510) om lufttransporter som gäller vid överträdelser av inform- ationsbestämmelser i tre andra EU-förordningar på luftfartens område. Det handlar om, för det första, artikel 14 i förordningen om nekad ombordstigning och, för det andra, artikel 11 i Europaparlamentets och rådets förordning (EG) nr 2111/2005 av den 14 december 2005 om upp- rättande av en gemenskapsförteckning över alla lufttrafikföretag som för- bjudits att bedriva verksamhet inom gemenskapen och om information till flygpassagerare om vilket lufttrafikföretag som utför en viss flygning, samt om upphävande av artikel 9 i direktiv 2004/36/EG. Det handlar vidare om artikel 4 i förordningen om rättigheter i samband med flyg- resor för personer med funktionshinder och personer med nedsatt rörlig- het. I dessa bestämmelser föreskrivs skyldigheter att lämna information om resenärers rätt till assistans och ersättning vid förseningar eller nekad ombordstigning, om vilket lufttrafikföretag som utför en flygning och om säkerhetsregler och eventuella begränsningar av transportmöjligheterna för personer med funktionsnedsättning.

Marknadsföringslagen används vid skyldigheter att lämna information

Som framgår av redogörelsen i avsnitt 4 innehåller tåg-, fartygs- och busspassagerarförordningarna ett antal bestämmelser om skyldighet för transportörer, terminaloperatörer, hamnmyndigheter, stationsförvaltare, järnvägsföretag, biljettutfärdare, resebyråer och researrangörer att lämna information. Det handlar om information som resenärerna behöver för att kunna planera och genomföra en resa, information om resenärernas rättigheter enligt respektive förordning samt information om tjänsternas kvalitet. Konsumentverket har getts tillsynsansvar över dessa bestämm- elser.

Information av detta slag ryms inom begreppet marknadsföring enligt 3 § marknadsföringslagen (2008:486). Marknadsföringslagens sanktions- system kan därför användas vid överträdelser av informationsbestämm- elserna. Det innebär att en transportör m.fl. som låter bli att lämna informationen kan åläggas av Marknadsdomstolen att vid vite göra det genom ett s.k. informationsföreläggande (24 §). Talan kan väckas av Konsumentombudsmannen, en näringsidkare som berörs av marknads- föringen eller en sammanslutning av konsumenter, näringsidkare eller löntagare (47 §). I ett fall som inte är av större vikt kan Konsument- ombudsmannen meddela ett informationsföreläggande för godkännande av den berörda näringsidkaren (28 §).

Som i andra fall när marknadsföringslagen tillämpas på informations- krav i annan lagstiftning bör det i den aktuella lagen anges att

marknadsföringslagen ska tillämpas vid överträdelse av informations- bestämmelserna och att informationen är att betrakta som väsentlig vid tillämpningen av marknadsföringslagen. Det bör också framgå att bestämmelserna om marknadsstörningsavgift i marknadsföringslagen inte är tillämpliga vid överträdelser av förordningarnas informationskrav. Det är nämligen som huvudregel inte möjligt att ålägga en sådan avgift om en näringsidkare bryter mot kraven enligt en särskild lag.

I 4 kap. 2 § lagen (2010:1065) om kollektivtrafik finns en skyldighet för kollektivtrafikföretag att lämna information om sitt trafikutbud till ett gemensamt system för trafikantinformation. Sanktioner mot överträdelser finns i 5 kap. 3 § i samma lag. Som konstateras i promemorian saknas det mot den bakgrunden skäl att införa någon ytterligare sanktion i förhållande till det motsvarande informationskravet i artikel 7 i tåg- passagerarförordningen.

Som framgått finns det i förordningen om gemensamma regler för tillhandahållande av lufttrafik i gemenskapen en skyldighet att tillhanda- hålla prisinformation. I artikel 23.1 anges vilken prisinformation som ska lämnas. Slutligt pris ska anges med särredovisning av passagerar- respektive fraktpris, skatter och avgifter. Valfria pristillägg ska klart, öppet och otvetydigt anges i början av varje bokningsprocess och kunden ska aktivt markera sitt godkännande av sådana tillägg. Även denna information ryms inom begreppet marknadsföring, varför marknads- föringslagens sanktionssystem kan tillämpas på samma sätt som beträff- ande informationskraven i passagerarförordningarna. Kravet på att kunden aktivt ska godkänna eventuella pristillägg föranleder i sig inte någon ytterligare sanktion. En överträdelse av bestämmelsen skulle nämligen innebära negativ avtalsbindning, vilket strider mot god mark- nadsföringssed. Konsumentombudsmannen kan därför redan på den grunden ingripa med stöd av marknadsföringslagen.

På luftfartens område finns tillämpliga sanktioner vid överträdelser av olika EU-rättsliga bestämmelser av konsumentskyddande karaktär samlade i lagen om lufttransporter. Det gäller bl.a. bestämmelser om skyldighet att tillhandahålla information. Av systematiska skäl bör därför prisinformationssanktionen införas i den lagen.

När det gäller de tre andra EU-förordningarna på luftfartens område finns en särskild marknadsrättslig sanktion vid liknande informationskrav i 15 § lagen om lufttransporter. Bestämmelsen innebär i korthet att Marknadsdomstolen, efter talan av bl.a. Konsumentombudsmannen, får meddela ett åläggande att lämna föreskriven information. Marknads- föringslagens bestämmelser om bl.a. åläggande att lämna information ska tillämpas. Regeringen delar bedömningen i promemorian att marknads- föringslagen är tillämplig även i dessa fall och att lagen om luft- transporter bör ändras i linje med detta. Den särskilda marknadsrättsliga sanktionen bör alltså utgå och ersättas av en bestämmelse om att marknadsföringslagen ska tillämpas på samma sätt som beträffande de andra EU-rättsliga informationskraven. Det innebär inte någon för- sämring av sanktionsmöjligheten.

Prop. 2013/14:239

31

Prop. 2013/14:239

32

En särskild marknadsrättslig sanktion används i andra fall

Det finns vissa andra konsumenträttsliga bestämmelser i passagerarför- ordningarna beträffande vilka det saknas sanktioner i svensk rätt eller där befintliga sanktioner är otillräckliga. Till denna kategori hör skyldig- heterna för transportörer m.fl. att utan diskriminering utfärda biljetter samt godkänna bokningar m.m., lämna assistans till resenärer med funktionsnedsättning (eller nedsatt rörlighet), fastställa icke-diskrim- inerande villkor för tillgänglighet för befordran av resenärer med funktionsnedsättning, inrätta en mekanism för hantering av klagomål samt, vad gäller fartygspassagerarförordningen, fastställa kvalitetsnormer för den assistans som erbjuds resenärer med funktionsnedsättning. Hit hör också skyldigheten för järnvägsföretag att inrätta normer för tjänste- kvalitet och lämna rapport om mottagna klagomål. Slutligen finns också kraven enligt fartygs- och busspassagerarförordningarna att vid skador på rörlighetsutrustning tillhandahålla tillfälliga ersättningshjälpmedel. I flera fall ger dessa bestämmelser en rätt till enskilda som kan göras gällande mot transportören eller motsvarande, exempelvis genom krav på pris- avdrag på grund av att tjänsten utförts på felaktigt sätt eller skadestånd på grund av att resenären orsakats kostnader. I vissa situationer som omfattas av förordningarnas bestämmelser kan en resenär också ha rätt till diskrimineringsersättning på grund av att resenären har diskriminerats i enlighet med diskrimineringslagen (2008:567). Bestämmelserna i för- ordningarna syftar dock också till att ge goda förutsättningar för resandet för hela resenärskollektivet, inbegripet personer som ännu inte ingått något avtal om resa. Det finns därför behov av att, utöver den möjlighet till individuella krav som kan finnas, införa sanktioner som skyddar dessa kollektiva rättigheter.

Eftersom det är fråga om bestämmelser av konsumentskyddande karaktär har Konsumentverket getts tillsynsansvar även över dessa bestämmelser. I linje med det ligger det närmast till hands att använda marknadsrättsliga sanktioner vid överträdelser. Marknadsföringslagen är dock inte tillämplig på samtliga de rättigheter och skyldigheter av varierande slag som det är fråga om här.

I promemorian föreslås att det med förebild i bl.a. 16 § lagen om lufttransporter ska införas en särskild marknadsrättlig sanktion vid överträdelser av bestämmelserna. Förslaget innebär att Marknadsdom- stolen kan ålägga den part som underlåter att uppfylla sin skyldighet enligt respektive förordning att göra det vid äventyr av vite. Talan om ett sådant åläggande får väckas av Konsumentombudsmannen. Om det är fråga om ett fall som inte är av större vikt, ska Konsumentombuds- mannen få meddela ett föreläggande om ett sådant åläggande. För dessa förelägganden ska vad som sägs i 28 § marknadsföringslagen gälla. Det innebär att ett föreläggande behöver godkännas av den berörda närings- idkaren omedelbart eller inom viss tid. Om så sker gäller föreläggandet som en lagakraftvunnen dom, i annat fall gäller det inte. För hanteringen av dessa mål och ärenden ska bestämmelser i lagen (1970:417) om mark- nadsdomstol m.m. gälla.

Förslaget innebär att Konsumentverket får ett effektivt verktyg för sin tillsyn. Konsumentombudsmannen och Marknadsdomstolen får dessutom anses väl lämpade för att hantera överträdelser av aktuella bestämmelser.

Någon synpunkt om att annan lagstiftning borde tillämpas i något av dessa fall lämnas inte heller av remissinstanserna. Regeringens slutsats är därför att promemorians förslag bör följas.

Det kan i detta sammanhang tilläggas att regeringen i ett tidigare lag- stiftningsärende beträffande ändringar i diskrimineringslagen har bedömt att en ordning där både diskrimineringsersättning och annan typ av sanktion i vissa fall kan komma i fråga, inte står i strid med rätten att inte bli lagförd eller straffad två gånger för samma brott enligt Europa- konventionens sjunde tilläggsprotokoll och EU:s stadga om de grund- läggande rättigheterna (prop. 2013/14:198 s. 53 f.).

Utöver vad som föreslås i promemorian anser regeringen att en särskild marknadsrättslig sanktion även bör gälla vid överträdelse av busspassag- erarförordningens bestämmelse om assistans vid olyckor (artikel 8). Skyldigheten att lämna assistans innefattar bl.a. tillhandahållande av mat, kläder och första hjälpen. Tillgodoseendet av sådana omedelbara prakt- iska behov rör resenärernas säkerhet vid inträffade olyckor. Det finns därför även i detta fall ett behov av att införa sanktioner som skyddar resenärernas kollektiva rättigheter. Detsamma gäller beträffande skyldig- heten enligt fartygs- och busspassagerarförordningarna för transportörer och terminaloperatörer att tillhandahålla tillfälliga ersättningshjälpmedel i händelse av förlust av eller skada på rörlighetshjälpmedel (artikel 15.4 respektive 17.3). Också beträffande järnvägsföretagens skyldighet att organisera alternativ transport när en förbindelse måste avbrytas och att intyga förseningar (artiklarna 18.3–18.5 i tågpassagerarförordningen) kan lämpligen samma slags sanktion användas.

En särskild marknadsrättslig sanktion är också aktuell vid överträdelser av det förbud mot diskriminering vid tillgång till passagerar- och frakt- priser som finns i artikel 23.2 i förordningen om gemensamma regler för tillhandahållande av lufttrafik i gemenskapen. Förbudet innebär konkret att passagerare och resebyråer ska ha möjlighet att boka biljetter till samma pris oavsett från vilket land bokningen sker. Marknadsförings- lagen är inte tillämplig i detta fall. Inte heller diskrimineringslagen omfattar samtliga situationer som är förbjudna enligt förordningen, t.ex. diskriminering på grund av lufttrafikföretagets etableringsort inom EU. Som föreslås i promemorian bör i stället en särskild marknadsrättslig sanktion av samma slag som nyss nämnts införas i lagen om luft- transporter. Med stöd av en sådan bestämmelse kan Marknadsdomstolen eller, i fall som inte är av större vikt, Konsumentombudsmannen vid vite förbjuda en näringsidkare att bryta mot diskrimineringsförbudet.

Regeringen delar bedömningen i promemorian att det inte i övrigt behövs några ytterligare sanktioner till förordningarnas bestämmelser om skadeståndsansvar m.m. vid personskada och förlorat eller skadat resgods, om ersättning och assistans vid förseningar och om ersättning för rörlighetshjälpmedel eller annan särskild utrustning. I dessa fall kan en resenär vända sig till allmän domstol eller till Allmänna reklamations- nämnden (ARN) för att få sin rätt enligt respektive förordning.

Vidare finns det redan sanktioner mot en transportör eller researrangör som i sina avtalsvillkor inskränker de rättigheter som en resenär har enligt tåg-, fartygs- eller busspassagerarförordningen. Som konstateras i promemorian kan bl.a. lagen (1994:1512) om avtalsvillkor i konsument- förhållanden (avtalsvillkorslagen) användas för att vid vite förbjuda en

Prop. 2013/14:239

33

Prop. 2013/14:239 näringsidkare att i framtiden använda ett avtalsvillkor som bedöms vara oskäligt. Exempel på oskäliga avtalsvillkor är sådana som avviker från tvingande regler, t.ex. en tvingande bestämmelse i någon av passagerar- förordningarna. Vidare kan den civilrättsliga bestämmelsen i 36 § avtals- lagen användas för att jämka eller lämna utan avseende ett avtalsvillkor som är oskäligt. Några ytterligare sanktioner vid avtalsvillkor som strider mot förordningarna behöver därför inte införas.

Sanktioner vid Transportstyrelsens tillsyn

Genom förordningen om behöriga myndigheter för resenärers rättigheter har Transportstyrelsen getts tillsynsansvaret över ett antal bestämmelser av teknisk karaktär i tågpassagerarförordningen. Det handlar om skyldig- heten att använda ett datoriserat informations- och bokningssystem för järnvägstrafik (CIRSRT), skyldigheten att se till att stationer, perronger, rullande materiel och andra inrättningar är tillgängliga för personer med funktionsnedsättning (eller nedsatt rörlighet) samt skyldigheten att vidta åtgärder för att trygga resenärernas personliga säkerhet (artiklarna 10.1, 10.2, 10.4, 21 och 26). Myndigheten har vidare getts tillsynsansvaret över bestämmelserna i fartygs- och busspassagerarförordningarna om skyldighet för transportörer (och terminaloperatörer) att inrätta ett förfarande för utbildning av sin personal om funktionsnedsättningar och funktionshinder (artikel 14 respektive 16). I samtliga nämnda fall behöver det finnas sanktioner att tillgå för att tillsynen ska bli effektiv.

Transportstyrelsen är tillsynsmyndighet även enligt järnvägslagen (2004:519) (se 1 kap. 2 § järnvägsförordningen, 2004:526) och har befogenhet att meddela de förelägganden och förbud som behövs för att lagen, eller de föreskrifter eller villkor som har meddelats med stöd av lagen, ska följas. Sådana förelägganden eller förbud får förenas med vite. Transportstyrelsens beslut får överklagas till allmän förvaltningsdomstol. Prövningstillstånd krävs vid överklagande till kammarrätten. (Se 8 kap. 4 § och 11 kap. 2 § järnvägslagen.)

I promemorian föreslås att befogenheten i järnvägslagen ska utvidgas till att omfatta också de aktuella bestämmelserna i tågpassagerarför- ordningen. Vidare föreslås att Transportstyrelsen ska ges motsvarande sanktionsmöjlighet som finns i järnvägslagen när det gäller tillsynen över fartygs- och busspassagerarförordningarna.

Sanktionssystemet i järnvägslagen ger Transportstyrelsen ett effektivt verktyg att komma till rätta med brister som uppdagas vid myndighetens tillsynsarbete enligt den lagen. Systemet är även väl lämpat för Transportstyrelsens tillsynsarbete enligt passagerarförordningarna. Myndigheten bör därför på motsvarande sätt som i järnvägslagen ges befogenhet att meddela de förelägganden som behövs för att bestämm- elserna i passagerarförordningarna ska följas och ges möjlighet att förena sådana förelägganden med en vitessanktion. Ett beslut om föreläggande bör kunna överklagas till allmän förvaltningsdomstol. Av systematiska skäl är det lämpligt att myndighetens sanktionsmöjligheter finns samlade i den nya lagen med kompletterande bestämmelser till förordningarna.

Lagrådet påpekar att det kan råda osäkerhet om huruvida det är tillsynsmyndighetens säte eller en eventuell regional eller lokal arbets-

enhet som ska vara avgörande i forumfrågan beträffande överklagande av

34

tillsynsmyndighetens beslut. Lagrådets påpekande föranleder ett tillägg i författningskommentaren till 9 § förslaget till lag med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar (avsnitt 9.1).

Som Transportstyrelsen anför är det inte lämpligt att, utöver möjligheten till vitesförelägganden, ge myndigheten rätt att återkalla ett tillstånd att bedriva järnvägstrafik, om skyldigheterna enligt tåg- passagerarförordningen inte fullgörs. Förutsättningarna för att återkalla ett sådant tillstånd är harmoniserade genom EU-direktivet om inrättande av ett gemensamt europeiskt järnvägsområde och en medlemsstat kan inte uppställa egna kriterier för återkallelse. Överträdelser av särskild lagstiftning som är tillämplig på transporter kan visserligen utgöra en omständighet som kan ligga till grund för ett beslut om återkallelse, men det är inte möjligt att föreskriva att återkallelse får ske enbart av det skälet att bestämmelser i tågpassagerarförordningen har överträtts. (Se artikel 24 i Europaparlamentets och rådets direktiv 2012/34/EU av den 21 november 2012 om inrättande av ett gemensamt europeiskt järnvägs- område.)

I tågpassagerarförordningen finns också ett krav på järnvägsföretag att ha tillräcklig försäkring för att kunna infria sitt skadeståndsansvar gentemot resenärerna enligt förordningen (artikel 12). Transport- styrelsens tillsynsansvar omfattar även denna skyldighet. Försäkrings- kravet har direkt betydelse för beslut om tillstånd att bedriva järnvägs- trafik enligt det nämnda EU-direktivet. Direktivet är genomfört genom bestämmelser i järnvägslagen, där det föreskrivs att ett järnvägsföretag ska ha en försäkring som täcker den skadeståndsskyldighet som kan uppkomma till följd av järnvägstrafik (3 kap. 2 § första stycket 4). Försäkringsskyldigheten är utformad på sådant sätt att den omfattar det krav på försäkring som ställs i artikel 12 i tågpassagerarförordningen. Transportstyrelsen har rätt att få de upplysningar och handlingar som behövs för tillsynen och kan vid vite förelägga företaget att rätta till förhållandena. I sista hand kan Transportstyrelsen återkalla licensen, om förutsättningarna för denna inte längre är uppfyllda (se 8 kap. 3–5 §§ järnvägslagen). Som anförs i promemorian finns det mot denna bakgrund inget behov av ytterligare sanktion vid överträdelse av försäkringskravet.

Bestämmelser om tillsyn

För att uppmärksamma att det finns tillsynsmyndigheter för passagerar- förordningarna är det lämpligt att det i lagen med kompletterande bestämmelser till förordningarna lämnas information om att regeringen utser sådana myndigheter.

På grund av krav i EU-rätten behöver det dessutom finnas bestämm- elser som säkerställer att Konsumentombudsmannen får tillgång till de uppgifter och handlingar som behövs för myndighetens tillsyn över efter- levnaden av bl.a. fartygs- och busspassagerarförordningarna. Kravet finns i Europaparlamentets och rådets förordning (EG) nr 2006/2004 av den 27 oktober 2004 om samarbete mellan de nationella tillsynsmyndig- heter som ansvarar för konsumentskyddslagstiftningen (”förordningen om konsumentskyddssamarbete”), och gäller de i bilagan till förordn- ingen uppräknade rättsakterna. För tillsynen över förordningarnas krav

Prop. 2013/14:239

35

Prop. 2013/14:239 på information finns bestämmelser om utrednings- och tillsyns- befogenheter i marknadsföringslagen som är tillämpliga. När det gäller tillsynen över de andra konsumenträttsliga bestämmelserna i förordn- ingarna, för vilka en särskild marknadsrättslig sanktion införs, krävs dock kompletterande utrednings- och tillsynsbefogenheter. För att få ett så enhetligt system som möjligt är det lämpligt att använda samma utrednings- och tillsynsbefogenheter som enligt marknadsföringslagen. Det kan ske genom att utrednings- och tillsynsbefogenheterna i marknadsföringslagen görs tillämpliga även i samband med Konsument- verkets tillsyn över andra konsumenträttsliga bestämmelser i passagerar- förordningarna än krav på information.

Konsumentverket utövar även tillsyn över att de skyldigheter som följer av artikel 23 i förordningen om gemensamma regler för tillhanda- hållande av lufttrafik i gemenskapen följs. Detta framgår av 6 § förord- ningen (1994:1808) om behöriga myndigheter på den civila luftfartens område. Konsumentverkets övriga tillsynsansvar på luftfartens område anges i lagen om lufttransporter. Det framstår mot denna bakgrund som lämpligt att också tillsynsansvaret rörande artikel 23 i förordningen anges i den lagen.

I likhet med den bedömning som görs i promemorian anser regeringen att det inte bör uppställas krav på att en resenär, som vill framföra klagomål till en myndighet med anledning av fartygs- eller busspassag- erarförordningen, först ska behöva vända sig till den berörda transport- ören eller terminaloperatören (jfr artikel 25.3 i fartygspassagerarförordn- ingen och artikel 28.3 i busspassagerarförordningen). I sammanhanget bör uppmärksammas att en prövning av Allmänna reklamationsnämnden förutsätter att det föreligger en tvist. Konsumenten ska därför normalt först ha vänt sig till näringsidkaren och denne ska ha motsatt sig konsumentens krav för att en prövning i nämnden ska bli aktuell. Vidare bör uppmärksammas att såväl fartygs- som busspassagerarförordningen föreskriver en reklamationsfrist under vilken ett klagomål ska framföras till transportören eller terminaloperatören (artikel 24.2 respektive 27). En resenär som vill begära ersättning med stöd av någon av förordningarna bör alltså beakta att reklamation ska ske.

Avgifter för Transportstyrelsens tillsyn

När det gäller Transportstyrelsens tillsyn aktualiseras frågan om avgifter. Riksdagen har beslutat att Transportstyrelsens verksamhet i fråga om ärendehandläggning, tillsyn och registerhållning i huvudsak ska finansi- eras med avgifter. I konsekvens med det infördes i 8 kap. 11 § järnvägs- lagen ett bemyndigande för regeringen eller den myndighet som regeringen bestämmer att meddela föreskrifter om avgifter för den tillsyn som sker enligt bl.a. tågpassagerarförordningen (se prop. 2010/11:30).

I enlighet med huvudprincipen om avgiftsfinansiering av Transport- styrelsens tillsynsverksamhet bör det införas en möjlighet att meddela föreskrifter om avgifter även för den tillsyn som Transportstyrelsen ska utöva enligt fartygs- och busspassagerarförordningarna. Det kan lämplig- en ske genom ett bemyndigande motsvarande det i järnvägslagen. Be- myndigandet i järnvägslagen bör vidare, i den del det avser avgifter för

den tillsyn som sker enligt tågpassagerarförordningen, flyttas till den nya

36

lagen med kompletterande bestämmelser till tåg-, fartygs- och buss- Prop. 2013/14:239 passagerarförordningarna. Härigenom samlas bestämmelser om Trans-

portstyrelsens tillsyn över förordningarna i en och samma lag.

Sverige uppfyller kraven på lagstiftning vid bussolyckor

Enligt artikel 7 i busspassagerarförordningen ska nationell lagstiftning ge resenärerna eller deras efterlevande rätt till ersättning vid dödsfall eller personskada på grund av en olycka som inträffar till följd av användning av en buss. Också rätt till ersättning för förlorat eller skadat resgods ska finnas vid sådana olyckor. Ersättningsbeloppen ska beräknas i enlighet med tillämplig nationell lag. Om den nationella lagen föreskriver ett maximibelopp för ersättning vid dödsfall och personskada eller vid förlorat eller skadat bagage, får beloppet i varje enskilt fall inte under- stiga 220 000 euro per resenär och 1 200 euro per kolli. I händelse av skada på rullstolar, annan rörlighetsutrustning eller hjälpmedel ska ersätt- ningsbeloppet alltid uppgå till kostnaden för att ersätta eller reparera den förlorade eller skadade utrustningen.

Regeringen delar promemorians bedömning att svensk lagstiftning uppfyller förordningens krav och att det därför saknas behov av ytterlig- are lagstiftning. Tillämpliga bestämmelser finns i skadeståndslagen (1972:207) och trafikskadelagen (1975:1410).

6 Befogenhet att utse bussterminaler

Regeringens förslag: Uppgiften att utse bussterminaler där assistans för personer med funktionsnedsättning eller nedsatt rörlighet ska till- handahållas i enlighet med busspassagerarförordningen ska över- lämnas till regeringen. Regeringen ska i sin tur få överlämna uppgiften åt en regional kollektivtrafikmyndighet eller en statlig myndighet.

Ett beslut av en regional kollektivtrafikmyndighet eller en statlig myndighet att utse en bussterminal ska kunna överklagas till allmän förvaltningsdomstol. Prövningstillstånd ska krävas vid överklagande till kammarrätten.

Promemorians förslag överensstämmer i huvudsak med regeringens (se promemorian s. 129 f.). I promemorian föreslås dock inte något i fråga om överklagande av en regional kollektivtrafikmyndighets eller en statlig myndighets beslut att utse en bussterminal.

Remissinstanserna: De flesta remissinstanserna tillstyrker förslaget eller har inga invändningar mot det.

Skälen för regeringens förslag: Enligt busspassagerarförordningen ska medlemsstaterna utse bussterminaler där assistans för personer med funktionsnedsättning (eller nedsatt rörlighet) ska tillhandahållas (artikel 12). Medlemsstaterna ska underrätta kommissionen, som ska tillhanda- hålla en förteckning över de utsedda bussterminalerna på internet.

I lagen om kollektivtrafik ges den regionala kollektivtrafikmyndig-

heten ett övergripande ansvar att verka för att kollektivtrafiken i länet

37

Prop. 2013/14:239 anpassas så att den är tillgänglig för alla resenärsgrupper. Den regionala kollektivtrafikmyndigheten ska i ett trafikförsörjningsprogram redovisa tidsbestämda mål och åtgärder för hur anpassning av kollektivtrafiken ska ske med hänsyn till behov hos personer med funktionsnedsättning. Vidare ska myndigheten definiera vilka bytespunkter och linjer som ska vara fullt tillgängliga för alla resenärer (2 kap. 10 §).

Mot bakgrund av hur ansvaret för den regionala kollektivtrafiken är ordnat är det naturligt att de regionala kollektivtrafikmyndigheterna även utser de bussterminaler där assistans för personer med funktionsned- sättning ska tillhandahållas enligt busspassagerarförordningen. För att lagstiftningen ska vara flexibel är det dock lämpligt att, som föreslås i promemorian, uppgiften att utse bussterminalerna primärt läggs på regeringen. Regeringen bör sedan kunna delegera uppgiften till de regionala kollektivtrafikmyndigheterna eller en statlig myndighet.

Som framgår medför ett beslut om att utse en bussterminal att transportörer och terminaloperatörer, inom sina respektive behörighets- områden, blir skyldiga att tillhandahålla närmare angiven assistans för personer med funktionsnedsättning. Ett sådant beslut av en regional kollektivtrafikmyndighet eller en statlig myndighet bör därför kunna överklagas till allmän förvaltningsdomstol av den transportör eller terminaloperatör som berörs av beslutet. Prövningstillstånd bör krävas vid överklagande till kammarrätten.

7 Ikraftträdande

Regeringens förslag: Den föreslagna lagstiftningen ska träda i kraft den 1 januari 2015.

Regeringens bedömning: Det behövs inga övergångsbestämmelser.

Promemorians förslag överensstämmer med regeringens utom så vitt avser datumet för ikraftträdande. I promemorian föreslås att lag- ändringarna ska träda i kraft den 1 juli 2014 (se promemorian s. 131 f.).

Remissinstanserna: De flesta remissinstanserna tillstyrker förslaget eller har inga invändningar mot det. Några remissinstanser, däribland

Samtrafiken och Sveriges Kommuner och Landsting, anser att föreslagen tidpunkt för ikraftträdande ligger för nära i tiden.

Skälen för regeringens förslag och bedömning: Den föreslagna lagstiftningens syfte är att komplettera vissa EU-förordningar. De aktuella förordningarna har trätt i kraft och är tillämpliga i Sverige. Lagstiftningen bör därför träda i kraft så snart som möjligt. Detta bedöms kunna ske den 1 januari 2015. Det behövs inte några övergångsbestämm- elser.

38

8

Ekonomiska och andra konsekvenser

Prop. 2013/14:239

Regeringens bedömning: Förslagen innebär vissa mindre kostnads- ökningar för Konsumentverket, Marknadsdomstolen och Transport- styrelsen. Dessa kommer dock inte bli större än att de ryms inom ramen för de nuvarande anslagen.

Promemorians bedömning överensstämmer med regeringens (se promemorian s. 133 f.).

Remissinstanserna: De flesta remissinstanserna lämnar bedömningen, såvitt avser de förslag som omfattas av propositionen, utan någon invändning. Regelrådet anser att konsekvensutredningen är bristfällig vad gäller promemorians förslag som helhet.

Skälen för regeringens bedömning: Konsumentverkets tillsynsansvar påverkas inte genom förslagen. I tillägg till vad som gäller i dag får Konsumentombudsmannen möjlighet att ingripa mot överträdelser av tåg-, fartygs- och busspassagerarförordningarna genom de föreslagna marknadsrättsliga sanktionsbestämmelserna. Dessutom tillkommer möjligheterna till marknadsrättsliga sanktioner vid överträdelser av förordningen om gemensamma regler för tillhandahållande av lufttrafik i gemenskapen. Förslagen kan i någon mån medföra ökade kostnader för Konsumentverket och Marknadsdomstolen. Eventuella kostnadsökningar bedöms dock bli så begränsade att de kan rymmas inom ramen för befintliga anslag.

Inte heller Transportstyrelsens tillsynsansvar påverkas av förslagen. För Transportstyrelsens del tillkommer möjligheterna att meddela de förelägganden som krävs för att vissa bestämmelser av teknisk karaktär i tågpassagerarförordningen ska efterlevas. Transportstyrelsen har redan motsvarande möjlighet vad gäller järnvägslagen och de föreskrifter eller villkor som meddelats med stöd av den lagen. Vidare får Transport- styrelsen möjlighet att meddela motsvarande föreläggande om en trans- portör eller terminaloperatör inte följer fartygs- eller busspassagerar- förordningens krav på utbildning av personal. Förslagen kan alltså med- föra visst merarbete för myndigheten. I likhet med Transportstyrelsen anser regeringen att utökningen av myndighetens uppdrag kan finansi- eras inom befintliga ramar.

De ekonomiska effekterna av att Transportstyrelsens tillsyn avgifts- beläggs bedöms endast vara marginella.

Dessutom finns förslaget att regeringen, eller de regionala kollektiv- trafikmyndigheter eller statliga myndigheter som regeringen bestämmer, ska få i uppgift att utse bussterminaler där assistans för personer med funktionsnedsättning eller nedsatt rörlighet ska tillhandahållas i enlighet med busspassagerarförordningen. Avsikten med förslaget är att de reg- ionala kollektivtrafikmyndigheterna i första hand ska utföra uppgiften. Mot bakgrund av de uppgifter som de regionala kollektivtrafikmyndig- heterna redan utför bedöms uppgiften att utse bussterminaler inte inne- bära några ytterligare kostnader.

Förslagen bedöms endast marginellt påverka antalet ärenden i all- männa förvaltningsdomstolar.

39

Prop. 2013/14:239 Förslagen påverkar inte antalet ärenden i allmänna domstolar eller ARN. Förslagen innebär inte heller kostnader för enskilda eller företag.

9 Författningskommentar

9.1Förslaget till lag med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar

Tåg-, fartygs- och busspassagerarförordningarna

1 § I denna lag finns bestämmelser som kompletterar

1. Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den

23 oktober 2007 om rättigheter och skyldigheter för tågresenärer (tågpassagerar- förordningen),

2. Europaparlamentets och rådets förordning (EU) nr 1177/2010 av den 24 november 2010 om passagerares rättigheter vid resor till sjöss och på inre vattenvägar och om ändring av förordning (EG) nr 2006/2004 (fartygspassagerar- förordningen), och

3. Europaparlamentets och rådets förordning (EU) nr 181/2011 av den 16 februari 2011 om passagerares rättigheter vid busstransport och om ändring av förordning (EG) nr 2006/2004 (busspassagerarförordningen).

I paragrafen anges att lagens bestämmelser kompletterar tåg-, fartygs- och busspassagerarförordningarna. Lagen gäller alltså när någon av för- ordningarna är tillämplig. Tillämpningsområdet för förordningarna fram- går av artikel 2 i respektive förordning.

Förordningarnas innehåll beskrivs i avsnitt 4 medan frågor om lagens innehåll behandlas i avsnitt 5 och 6.

Tillsyn över att förordningarna följs

2 § Den eller de myndigheter som regeringen bestämmer utövar tillsyn över att de skyldigheter som följer av tåg-, fartygs- och busspassagerarförordningarna fullgörs.

I paragrafen informeras om att regeringen utser den eller de myndigheter som ska utöva tillsyn över att tåg-, fartygs- och busspassagerarförordn- ingarna följs.

Att en eller flera tillsynsmyndigheter ska utses framgår av artikel 30 i tågpassagerarförordningen, artikel 25 i fartygspassagerarförordningen och artikel 28 i busspassagerarförordningen. Av förordningarna framgår även vad tillsynen ska omfatta. Tillsynen är framför allt inriktad på att säkerställa att bl.a. transportörer uppfyller de skyldigheter gentemot resenärerna som följer av respektive förordning.

40

Prop. 2013/14:239

3 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om avgifter för tillsyn enligt tåg-, fartygs- och busspassagerar- förordningarna.

I paragrafen bemyndigas regeringen att meddela föreskrifter om avgifter för tillsyn enligt tåg-, fartygs- och busspassagerarförordningarna. Reger- ingen ges även möjlighet att i sin tur bemyndiga en myndighet att med- dela sådana föreskrifter. Övervägandena finns i avsnitt 5.

I 2 § informeras om att regeringen bestämmer vilka myndigheter som utövar tillsyn över att tåg-, fartygs- och busspassagerarförordningarna följs. I 8 kap. 11 § järnvägslagen (2004:519) finns ett bemyndigande för regeringen eller den myndighet som regeringen bestämmer att meddela föreskrifter om avgifter för den tillsyn som sker enligt tågpassagerar- förordningen. Det bemyndigandet flyttas till förevarande paragraf. I paragrafen införs också ett likadant bemyndigande i fråga om föreskrifter om avgifter för tillsyn enligt fartygs- och busspassagerarförordningarna.

Sanktioner

4 § Skyldighet att lämna information föreskrivs för järnvägsföretag, biljett- utfärdare, stationsförvaltare, researrangörer, transportörer, resebyråer, terminal- operatörer och hamnmyndigheter i

1. artiklarna 4, 8, 9.5, 18.1, 20, 22.3, 28.2 och 29 i tågpassagerarförordningen, 2. artiklarna 8.5, 9.2–9.4, 10, 12.3, 13.3, 16, 22 och 23 i fartygspassagerar-

förordningen, och

3. artiklarna 10.2, 10.5, 11.2–11.5, 13.2, 14.5, 20, 24 och 25 i busspassagerar- förordningen.

Om information inte lämnas enligt någon av de bestämmelser som anges i första stycket, ska marknadsföringslagen (2008:486) tillämpas, med undantag av 29–36 §§ om marknadsstörningsavgift. Sådan information ska anses vara väsentlig enligt 10 § tredje stycket den lagen.

Paragrafen innebär att sanktionssystemet i marknadsföringslagen ska tillämpas om information inte lämnas enligt vissa artiklar i de tre passagerarförordningarna. Övervägandena finns i avsnitt 5.

Tåg-, fartygs- och busspassagerarförordningarna innehåller bestämm- elser om skyldighet att lämna information i vissa fall, bl.a. information om förseningar, resevillkor, tillgänglighet för personer med funktions- nedsättning eller nedsatt rörlighet och de rättigheter som resenärerna har enligt förordningarna.

Om den som ansvarar för att lämna informationen underlåter detta eller lämnar den på ett oklart, obegripligt, tvetydigt eller annat olämpligt sätt, utgör det normalt vilseledande marknadsföring enligt 10 § marknads- föringslagen. Enligt förevarande paragraf tillämpas marknadsförings- lagens sanktionssystem i dessa fall. Informationen är väsentlig i mark- nadsföringslagens mening.

Det saknar betydelse om skyldigheten att tillhandahålla informationen infaller före, under eller efter försäljningen eller det att tjänsten utförts (se 3 § marknadsföringslagen). Bestämmelsen är alltså tillämplig på information som enligt förordningarna ska lämnas inför eller vid ingåendet av transportavtalet men även på information som ska lämnas inför, under eller efter resan.

41

Prop. 2013/14:239

42

Den ansvariga näringsidkaren kan, om övriga förutsättningar enligt marknadsföringslagen är uppfyllda, åläggas att lämna informationen vid äventyr av vite, ett s.k. informationsföreläggande (24 och 26 §§ marknadsföringslagen). En talan om åläggande väcks vid Marknads- domstolen och får väckas av bl.a. Konsumentombudsmannen. I ett fall som inte är av större vikt får Konsumentombudsmannen meddela ett informationsföreläggande för godkännande av den berörda närings- idkaren (28 § marknadsföringslagen).

Marknadsföringslagens bestämmelser om marknadsstörningsavgift ska inte tillämpas i de fall som omfattas av paragrafen. Motsvarande undan- tag finns i bl.a. 13 § lagen (2010:510) om lufttransporter.

5 § Andra skyldigheter än att lämna information föreskrivs för järnvägsföretag, biljettutfärdare, stationsförvaltare, researrangörer, transportörer, resebyråer och terminaloperatörer i

1.artiklarna 9.1–9.4, 18.3–18.5, 19, 22.1, 23, 24, 27 och 28 i tågpassagerar- förordningen,

2.artiklarna 4, 7–8.4, 9.1, 10–13.2, 15.4 och 24 i fartygspassagerar- förordningen, och

3.artiklarna 4, 8, 9, 10.1, 10.3, 10.4, 11.1, 13–15, 17.3, 26 och 27 i buss- passagerarförordningen.

Den som inte fullgör en sådan skyldighet får åläggas att göra det. Åläggandet får förenas med vite. En talan om ett sådant åläggande väcks vid Marknads- domstolen av Konsumentombudsmannen.

I ett tillsynsärende om en skyldighet som avses i första stycket tillämpas 42– 45 §§ marknadsföringslagen (2008:486) och det som i övrigt gäller enligt den lagen vid tillämpning av de bestämmelserna.

Genom paragrafen införs en särskild marknadsrättslig sanktion vid överträdelser av vissa konsumenträttsliga bestämmelser i passagerarför- ordningarna som inte avser information. Dessutom ges Konsument- ombudsmannen vissa utrednings- och tillsynsbefogenheter. Överväg- andena finns i avsnitt 5.

I tåg-, fartygs- och busspassagerarförordningarna finns bestämmelser som innebär en rad skyldigheter för järnvägsföretag m.fl. som är av kon- sumenträttslig karaktär. Det handlar bl.a. om skyldighet att utan diskrim- inering utfärda biljetter samt godkänna bokningar, lämna assistans till resenärer med funktionsnedsättning eller nedsatt rörlighet och inrätta mekanismer för hantering av klagomål. I första stycket anges de be- stämmelser i passagerarförordningarna där dessa skyldigheter återfinns.

Enligt andra stycket kan den som inte uppfyller nämnda skyldigheter åläggas att göra det. Åläggandet får förenas med vite. Liknande be- stämmelser finns i bl.a. 3 och 4 §§ lagen (1994:1512) om avtalsvillkor i konsumentförhållanden (avtalsvillkorslagen) och 16 § lagen (2010:510) om lufttransporter.

Ett åläggande kan riktas till det järnvägsföretag eller den biljett- utfärdare, stationsförvaltare, researrangör, transportör, resebyrå eller terminaloperatör som enligt respektive passagerarförordning är skyldig att vidta den aktuella åtgärden. Ett åläggande kommer i regel innebära att det berörda företaget i framtiden måste rätta sig efter bestämmelsen i aktuellt avseende för att undvika att ett vite döms ut.

Syftet med bestämmelsen är främst att skydda resenärerna som kollektiv mot att ansvariga företag underlåter att uppfylla sina skyldig- heter enligt passagerarförordningarna. Vitessanktionen kan endast an-

vändas vid framtida överträdelser och inte för att kompensera resenärer som lidit skada. En resenär som vill få kompensation har – för det fall den som kravet riktas mot inte godtar resenärens krav – i stället att göra en anmälan till Allmänna reklamationsnämnden alternativt väcka talan vid allmän domstol.

En talan om ett åläggande enligt andra stycket väcks vid Marknads- domstolen. Lagen (1970:417) om marknadsdomstol m.m. tillämpas på det förfarandet. Konsumentombudsmannen är ensam behörig att väcka talan.

Enligt tredje stycket tillämpas 42–45 §§ marknadsföringslagen i ett tillsynsärende om en skyldighet som avses i första stycket. Det innebär att Konsumentombudsmannen har vissa i de bestämmelserna närmare angivna utrednings- och tillsynsbefogenheter. Vidare ska också andra bestämmelser i marknadsföringslagen som är aktuella vid en tillämpning av 42–45 §§ gälla. Det handlar bl.a. om de processuella bestämmelserna i 49, 51 och 57 §§ om utdömande av vite, överklagande och rättens sammansättning.

6 § I ett fall som inte är av större vikt får Konsumentombudsmannen meddela ett föreläggande om ett sådant åläggande som avses i 5 §. Bestämmelserna i 28 § marknadsföringslagen (2008:486) ska då tillämpas.

Genom paragrafen införs en möjlighet för Konsumentombudsmannen att meddela förelägganden i frågor som omfattas av 5 §. Övervägandena finns i avsnitt 5.

Konsumentombudsmannen har möjlighet att, i fall som inte är av större vikt, meddela förelägganden om sådana ålägganden som avses i 5 §. Bestämmelsen är utformad med 28 § marknadsföringslagen som förebild. Den är, på samma sätt som 28 § marknadsföringslagen, begränsad till fall som inte är av större vikt, dvs. klara fall som inte har principiellt intresse eller rör åtgärder av stor praktisk räckvidd (jfr prop. 1970:57 s. 84 f.).

Ett föreläggande ska förenas med vite och näringsidkaren måste godkänna föreläggandet inom viss tid. Om föreläggandet godkänns inom denna tid, gäller det som en lagakraftvunnen dom. Detta innebär bl.a. att Marknadsdomstolen inte kan pröva frågan på nytt så länge inte förhållandena ändrats, se 53 § marknadsföringslagen. Ett godkännande som sker efter den utsatta tiden är dock utan verkan. Skulle en närings- idkare vilja godkänna ett föreläggande efter tidens utgång, måste alltså ett nytt föreläggande utfärdas.

7 § Den myndighet som utövar tillsyn över fullgörandet av de skyldigheter som anges i artiklarna 10.1, 10.2, 10.4, 21 och 26 i tågpassagerarförordningen, artikel 14 i fartygspassagerarförordningen och artikel 16.1 i busspassagerar- förordningen får meddela de förelägganden som behövs för att bestämmelserna ska följas.

Ett sådant föreläggande får förenas med vite.

Paragrafen reglerar tillsynsmyndighetens befogenheter att meddela de förelägganden som behövs för att passagerarförordningarnas bestämm- elser av teknisk karaktär och om skyldighet att införa förfaranden för utbildning om funktionsnedsättningar m.m. ska uppfyllas. Över- vägandena finns i avsnitt 5.

Prop. 2013/14:239

43

Prop. 2013/14:239 I 2 § informeras om att regeringen bestämmer vilken myndighet som utövar tillsyn över att berörda aktörer fullgör de skyldigheter som följer av bl.a. artiklarna 10.1, 10.2, 10.4, 21 och 26 i tågpassagerarförordn- ingen, artikel 14 i fartygspassagerarförordningen och artikel 16.1 i buss- passagerarförordningen. Nämnda artiklar i tågpassagerarförordningen föreskriver skyldighet för järnvägsföretag m.fl. att använda ett datoriserat informations- och bokningssystem för järnvägstrafik (CIRSRT), att se till att stationer, perronger, rullande materiel och andra inrättningar är till- gängliga för personer med funktionsnedsättning (eller nedsatt rörlighet) samt att vidta åtgärder för att trygga resenärernas personliga säkerhet. De angivna artiklarna i fartygs- och busspassagerarförordningarna före- skriver en skyldighet för transportörer och, i förekommande fall, terminaloperatörer att inrätta förfaranden för utbildning om funktions- hinder och funktionsnedsättningar.

Enligt första stycket får den myndighet som utsetts att utöva tillsyn över att dessa skyldigheter följs meddela förelägganden för att säkerställa efterlevnaden. Det innebär exempelvis en möjlighet att inom ramen för vad som föreskrivs i de EU-harmoniserade tekniska specifikationerna för driftskompatabilitet (TSD) förelägga en stationsförvaltare eller ett järnvägsföretag att, i samband med en ombyggnation av en station eller vid inköp av nya järnvägsvagnar, göra de anpassningar för personer med funktionsnedsättning som krävs enligt specifikationerna.

Att ett föreläggande får förenas med vite framgår av andra stycket. Bestämmelser om överklagande av tillsynsmyndighetens beslut om

föreläggande finns i 9 §. För vitesförelägganden gäller i övrigt bestämm- elserna i lagen (1985:206) om viten. Frågor om utdömande av viten prövas i förevarande fall av allmän förvaltningsdomstol på ansökan av den myndighet som har utfärdat vitesföreläggandet, dvs. tillsynsmyndig- heten.

Befogenhet att utse bussterminaler

8 § Regeringen eller, efter regeringens bestämmande, en statlig myndighet eller de regionala kollektivtrafikmyndigheter som avses i lagen (2010:1065) om kollektivtrafik får i det enskilda fallet besluta om att utse bussterminaler där assistans för personer med funktionsnedsättning eller nedsatt rörlighet ska tillhandahållas i enlighet med busspassagerarförordningen.

I paragrafen ges regeringen befogenhet att utse de bussterminaler där assistans till personer med funktionsnedsättning eller nedsatt rörlighet ska tillhandahållas i enlighet med busspassagerarförordningen. Reger- ingen ges även möjlighet att delegera uppgiften till en statlig myndighet eller till de regionala kollektivtrafikmyndigheterna. Övervägandena finns i avsnitt 6.

Skyldigheten att utse bussterminaler där assistans ska tillhandahållas framgår av artikel 12 i busspassagerarförordningen. Vad som avses med regionala kollektivtrafikmyndigheter och hur de kan vara organiserade framgår av lagen om kollektivtrafik.

Bestämmelser om överklagande av en statlig myndighets eller en regional kollektivtrafikmyndighets beslut att utse bussterminaler finns i 9 §.

44

Överklagande

Prop. 2013/14:239

9 § Tillsynsmyndighetens beslut om föreläggande enligt 7 § får överklagas till allmän förvaltningsdomstol. Detsamma gäller ett beslut av en statlig myndighet

eller en regional kollektivtrafikmyndighet om att utse en bussterminal enligt 8 §. Prövningstillstånd krävs vid överklagande till kammarrätten.

Av paragrafen framgår att vissa beslut enligt 7 och 8 §§ får överklagas. Övervägandena finns i avsnitt 5 och 6.

Enligt första stycket får tillsynsmyndighetens beslut om föreläggande enligt 7 § och en statlig myndighets eller en regional kollektivtrafik- myndighets beslut om att utse en bussterminal enligt 8 § överklagas till allmän förvaltningsdomstol. Ett beslut av regeringen om att utse en buss- terminal enligt 8 § kan däremot inte överklagas.

Den allmänna forumregeln i 14 § lagen (1971:289) om allmänna förvaltningsdomstolar är tillämplig när tillsynsmyndighetens beslut om föreläggande enligt 7 § eller en statlig myndighets eller en regional kollektivtrafikmyndighets beslut om att utse en bussterminal enligt 8 § överklagas till allmän förvaltningsdomstol. Enligt 14 § andra stycket lagen om allmänna förvaltningsdomstolar ska överklagandet prövas av den förvaltningsrätt inom vars domkrets ärendet först prövats.

Transportstyrelsen är enligt nuvarande ordning den tillsynsmyndighet som avses i 7 §. I myndigheter med hela landet som verksamhetsområde anses forumregeln enligt praxis innebära att det är den beslutande enhetens geografiska placering som avgör var beslutet ska anses fattat (RÅ 1995 ref. 20). I förevarande fall torde det alltså vara den beslutande enhetens geografiska placering som avgör vilken domstol som blir be- hörig att pröva ett överklagande (jfr prop. 2008/09:31 s. 65).

Uppräkningen av beslut som får överklagas är inte uttömmande. Bestämmelser om överklagande av beslut enligt 4 och 5 §§ finns i marknadsföringslagen respektive lagen om marknadsdomstol m.m. (se vidare kommentarerna till de paragraferna).

Prövningstillstånd krävs vid överklagande till kammarrätten enligt andra stycket.

9.2Förslaget till lag om ändring i lagen (1970:417) om marknadsdomstol m.m.

1 § Marknadsdomstolen handlägger mål och ärenden enligt

1.konkurrenslagen (2008:579),

2.marknadsföringslagen (2008:486),

3.lagen (1994:1512) om avtalsvillkor i konsumentförhållanden,

4.lagen (1984:292) om avtalsvillkor mellan näringsidkare,

5.lagen (2000:1175) om talerätt för vissa utländska konsumentmyndigheter och konsumentorganisationer,

6.försäkringsavtalslagen (2005:104),

7.lagen (2005:590) om insyn i vissa finansiella förbindelser m.m.,

8.lagen (2006:484) om franchisegivares informationsskyldighet,

9.lagen (2010:510) om lufttransporter,

10.lagen (1986:436) om näringsförbud,

11.lagen (2010:1350) om uppgiftsskyldighet i fråga om marknads- och

konkurrensförhållanden, och

45

Prop. 2013/14:239 12. lagen (2014:000) med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar.

Bestämmelserna i 14–22 §§ tillämpas inte i mål eller ärenden enligt konkurrenslagen, marknadsföringslagen, försäkringsavtalslagen, lagen om insyn i vissa finansiella förbindelser m.m., lagen om franchisegivares informations- skyldighet, 13 eller 15 § lagen om lufttransporter, lagen om näringsförbud, lagen om uppgiftsskyldighet i fråga om marknads- och konkurrensförhållanden eller 4 § lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och buss- passagerarförordningar. I mål enligt marknadsföringslagen, försäkringsavtals- lagen eller lagen om franchisegivares informationsskyldighet tillämpas inte heller 13 a §. I stället gäller rättegångsreglerna i dessa lagar.

Paragrafen innehåller en förteckning över de mål och ärenden som handläggs vid Marknadsdomstolen samt en reglering av i vilka fall lagens rättegångsregler ska tillämpas. Övervägandena finns i avsnitt 5.

Ändringen i första stycket innebär att lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar läggs till i förteckningen över de lagar enligt vilka Marknadsdomstolen handlägger mål och ärenden.

Mål och ärenden enligt lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar handläggs av Marknadsdomstolen i enlighet med övriga bestämmelser i lagen om marknadsdomstol m.m. Genom en ändring i andra stycket undantas dock 4 § lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar från tillämpningen av rättegångsreglerna i 14–22 §§ i förevarande lag. Dessutom förtydligas att undantaget beträff- ande lagen om lufttransporter avser 13 och 15 §§ i den lagen. I dessa fall tillämpas i stället marknadsföringslagens rättegångsregler.

9.3Förslaget till lag om ändring i lagen (1992:1672) om paketresor

18 § Vissa skador, som omfattas av andra bestämmelser, ersätts enligt de bestämmelserna i stället för enligt denna lag. Detta gäller skador som omfattas av bestämmelserna i

1. sjölagen (1994:1009),

2.rådets förordning (EG) nr 2027/97 av den 9 oktober 1997 om lufttrafik- företags skadeståndsansvar avseende lufttransport av passagerare och deras bagage,

3.lagen (2010:510) om lufttransporter,

4. Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer,

5.järnvägstrafiklagen (1985:192), eller

6.lagen (1985:193) om internationell järnvägstrafik.

Arrangören är dock alltid skyldig att ersätta resenären för vad denne har rätt att fordra enligt de nämnda bestämmelserna.

Av paragrafen framgår att paketreselagen inte ska tillämpas vid vissa skador som omfattas av annan lagstiftning.

Genom en ändring i första stycket läggs tågpassagerarförordningen till i den förteckning över lagstiftning som ska tillämpas i stället för paket-

reselagen. Det innebär att skador som omfattas av bestämmelser i

46

förordningen ersätts enligt de bestämmelserna i stället för enligt paket- Prop. 2013/14:239 reselagen. Övriga ändringar i stycket är redaktionella.

Ändringen är föranledd av att delar av fördraget om internationell järnvägstrafik, COTIF, har införlivats i svensk rätt genom tågpassagerar- förordningen. Det gäller bl.a. bestämmelser om skadeståndsskyldighet enligt de enhetliga rättsreglerna för avtal om internationell transport av resande på järnväg (CIV, bihang A till fördraget), vilka är intagna som bilaga 1 till förordningen.

Bestämmelserna i CIV reglerar förutsättningarna för skadestånd och skadeståndets storlek samt vem som bär det slutliga ansvaret för skadan. Paketreselagen fortsätter dock att gälla i fråga om skador som inte regleras i CIV.

Av det nya andra stycket, som enligt hittillsvarande lydelse utgör paragrafens sista mening, följer att arrangörens primära ansvar gentemot resenären även omfattar skadestånd enligt CIV. Resenären kan alltså alltid vända sig till arrangören för att få det skadestånd som han eller hon har rätt till enligt de aktuella bestämmelserna i CIV. Det finns dock inte något hinder mot att resenären i stället riktar sitt anspråk mot den som bär det slutliga ansvaret (se prop. 1992/93:95 s. 94 f.).

9.4Förslaget till lag om ändring i järnvägslagen (2004:519)

1 kap. Allmänna bestämmelser Lagens tillämpningsområde

2 § Särskilda bestämmelser om befordran av passagerare finns i Europa- parlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer. Dessutom finns särskilda bestämmelser om befordran av passagerare och gods i järnvägstrafiklagen (1985:192) och i lagen (1985:193) om internationell järnvägstrafik.

I paragrafen lämnas upplysning om viss till järnvägslagen angränsande lagstiftning. Genom ett tillägg erinras om att särskilda bestämmelser om transport av passagerare även finns i tågpassagerarförordningen. Be- stämmelserna i förordningen omfattar inte bara passagerare utan också deras resgods.

8 kap. Tillsyn m.m. Bemyndigande

11 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om avgifter för tillsyn, registrering och ärendehandläggning enligt denna lag, enligt föreskrifter som har meddelats med stöd av lagen samt enligt kommissionens förordning (EG) nr 62/2006 av den 23 december 2005 om teknisk specifikation för driftskompatibilitet (TSD) avseende delsystemet ”Telematik- applikationer för godstrafik” i det transeuropeiska järnvägssystemet för konvent- ionella tåg och kommissionens förordning (EG) nr 352/2009 av den 24 april 2009 om antagande av en gemensam säkerhetsmetod för riskvärdering och riskbe- dömning som avses i artikel 6.3 a i Europaparlamentets och rådets direktiv 2004/49/EG.

47

Prop. 2013/14:239 Paragrafen innehåller bemyndiganden. Den ändras på så sätt att bemyndigandet att meddela föreskrifter om avgifter för tillsyn enligt tåg- passagerarförordningen lyfts ut från paragrafen. Bemyndigandet flyttas till den nya lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar (se den föreslagna 3 § i den lagen). I övrigt görs en redaktionell ändring. Övervägandena finns i avsnitt 5.

9.5Förslaget till lag om ändring i marknadsföringslagen (2008:486)

1 § Denna lag har till syfte att främja konsumenternas och näringslivets intressen i samband med marknadsföring av produkter och att motverka marknadsföring som är otillbörlig mot konsumenter och näringsidkare.

Bestämmelser om marknadsföring finns bl.a. i

lagen (1992:1672) om paketresor,

tobakslagen (1993:581),

lagen (1995:1571) om insättningsgaranti,

lagen (1996:1006) om anmälningsplikt avseende viss finansiell verksamhet,

lagen (1996:1118) om marknadsföring av kristallglas,

lagen (1999:268) om betalningsöverföringar inom Europeiska ekonomiska samarbetsområdet,

lagen (1999:158) om investerarskydd,

lagen (2002:562) om elektronisk handel och andra informationssamhällets

tjänster,

lagen (2004:299) om inlåningsverksamhet,

prisinformationslagen (2004:347),

lagen (2005:59) om distansavtal och avtal utanför affärslokaler,

försäkringsavtalslagen (2005:104),

lagen (2005:405) om försäkringsförmedling,

lagen (2006:484) om franchisegivares informationsskyldighet,

lagen (2010:510) om lufttransporter,

radio- och tv-lagen (2010:696),

alkohollagen (2010:1622),

konsumentkreditlagen (2010:1846),

lagen (2011:914) om konsumentskydd vid avtal om tidsdelat boende eller långfristig semesterprodukt,

lagen (2013:1054) om marknadsföring av modersmjölksersättning och tillskottsnäring, och

lagen (2014:000) med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar.

I paragrafen finns bl.a. en lista över lagar som innehåller bestämmelser om marknadsföring. Listan kompletteras med lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar.

48

9.6Förslaget till lag om ändring i lagen (2010:510) om lufttransporter

Bestämmelser med anledning av förordning (EG) nr 261/2004, förordning (EG) nr 2111/2005, förordning (EG) nr 1107/2006 och förordning (EG) nr 1008/2008

14 § Konsumentverket ska utöva tillsyn över att lufttrafikföretag, deras agenter, researrangörer och biljettförsäljare fullgör de skyldigheter som följer av

1.förordning (EG) nr 261/2004,

2.artiklarna 11 och 12 i förordning (EG) nr 2111/2005,

3.artiklarna 3 och 4 i förordning (EG) nr 1107/2006, och

4.artikel 23 i förordning (EG) nr 1008/2008.

I paragrafen ges Konsumentverket befogenhet att utöva tillsyn över att vissa EU-förordningar följs. Övervägandena finns i avsnitt 5.

Det framgår av 6 § förordningen (1994:1808) om behöriga myndig- heter på den civila luftfartens område att Konsumentverket har tillsyns- ansvar över att artikel 23 i Europaparlamentets och rådets förordning (EG) nr 1008/2008 av den 24 september 2008 om gemensamma regler för tillhandahållande av lufttrafik i gemenskapen följs. Genom en ny punkt 4 flyttas denna reglering till lagen. Övriga ändringar är redakt- ionella.

Artikel 23 innehåller bestämmelser om vilken prisinformation som ska lämnas till kunden, hur prisinformationen ska lämnas samt ett krav på att kunden aktivt ska markera sitt godkännande av eventuella pristillägg. I 15 och 16 §§ regleras vilka sanktioner som kan användas vid över- trädelser av artikeln.

15 § Skyldighet att lämna information föreskrivs för lufttrafikföretag, deras agenter, researrangörer och biljettförsäljare i

1.artikel 14 i förordning (EG) nr 261/2004,

2.artikel 11 i förordning (EG) nr 2111/2005,

3.artiklarna 4.3 och 4.4 i förordning (EG) nr 1107/2006, och

4.artikel 23.1 i förordning (EG) nr 1008/2008.

Om information inte lämnas enligt någon av de bestämmelser som anges i första stycket, ska marknadsföringslagen (2008:486) tillämpas, med undantag av 29–36 §§ om marknadsstörningsavgift. Sådan information ska anses vara väsentlig enligt 10 § tredje stycket den lagen.

I paragrafen föreskrivs en sanktion för det fall information inte lämnas i enlighet med vissa EU-förordningar. Övervägandena finns i avsnitt 5.

Av de aktuella bestämmelserna i EU-förordningarna följer en skyldig- het att informera passagerarna om deras rättigheter, om vilket eller vilka lufttrafikföretag som utför flygningen, om de säkerhetsregler och begränsningar som tillämpas på transport av personer med funktions- nedsättning (eller nedsatt rörlighet) samt om skälen till att en person med funktionsnedsättning vägrats resa.

Enligt hittillsvarande ordning gäller att en särskild marknadsrättslig sanktion ska tillämpas vid underlåtenhet att lämna den information som anges i respektive EU-förordning. Enligt denna kan bl.a. ett lufttrafik- företag åläggas att lämna den aktuella informationen. Ändringen innebär

Prop. 2013/14:239

49

Prop. 2013/14:239 att den sanktionen upphävs. I stället anges att marknadsföringslagen, med undantag av lagens bestämmelser om marknadsstörningsavgift, ska tillämpas i dessa fall. Beträffande förordning (EG) nr 1107/2006 förtyd- ligas vilka delar av artikel 4 som innehåller krav på information. Vidare utvidgas paragrafens tillämpningsområde till att även omfatta inform- ation enligt artikel 23.1 i förordning (EG) nr 1008/2008. Av den artikeln följer att slutligt pris ska anges med särredovisning av passagerar- respektive fraktpris, skatter och avgifter. Valfria pristillägg ska klart, öppet och otvetydigt anges i början av varje bokningsprocess. I para- grafen anges också att den information som avses i förordningarna ska anses vara väsentlig enligt 10 § tredje stycket marknadsföringslagen. Motsvarande gäller enligt den föreslagna 4 § lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar. För en närmare beskrivning av innebörden hänvisas därför till kommentaren till den paragrafen.

16 § Ett lufttrafikföretag, dess agent eller en researrangör som vägrar personer med funktionsnedsättning eller nedsatt rörlighet transport i strid med artiklarna 3–4.2 i förordning (EG) nr 1107/2006 får åläggas att erbjuda transporterna i fråga. Åläggandet får förenas med vite.

Ett lufttrafikföretag, dess agent eller en researrangör som erbjuder priser på ett diskriminerande sätt i strid med artikel 23.2 i förordning (EG) nr 1008/2008 får förbjudas att göra det. Förbudet får förenas med vite.

Talan om åläggande enligt första stycket och förbud enligt andra stycket väcks vid Marknadsdomstolen av Konsumentombudsmannen.

I paragrafen föreskrivs en särskild marknadsrättslig sanktion vid över- trädelser av vissa konsumenträttsliga bestämmelser i två EU-förordn- ingar. Övervägandena finns i avsnitt 5.

Ändringarna i första stycket är redaktionella. Beträffande EU- förordningen förtydligas vilka delar av artikel 4 som innehåller bestämmelser om förbud mot att vägra transport.

Andra stycket innehåller enligt hittillsvarande lydelse en bestämmelse om att talan enligt första stycket väcks vid Marknadsdomstolen av Konsumentombudsmannen. Den bestämmelsen flyttas till tredje stycket. Andra stycket innehåller i stället en ny bestämmelse som innebär att ett lufttrafikföretag, dess agent eller en researrangör som bryter mot diskrimineringsförbudet i artikel 23.2 i förordning (EG) nr 1008/2008 kan vid vite förbjudas att göra det. Enligt artikel 23.2 i EU-förordningen ska tillgång till passagerar- och fraktpriser ges utan någon diskriminering på grundval av kunders nationalitet eller bosättningsort eller på grundval av lufttrafikföretagsombudets eller annan biljettförsäljares etableringsort inom gemenskapen.

Av tredje stycket, som är nytt, framgår att talan enligt första eller andra stycket väcks vid Marknadsdomstolen av Konsumentombudsmannen. Bestämmelsen, som enligt hittillsvarande ordning finns i andra stycket, ändras så att den även omfattar en talan om förbud enligt det nya andra stycket. Lagen om marknadsdomstol m.m. tillämpas på förfarandet (jfr kommentaren till förslaget om ändring i lagen om marknadsdomstol m.m.).

50

17 § I ett fall som inte är av större vikt får Konsumentombudsmannen meddela

Prop. 2013/14:239

ett föreläggande om ett sådant åläggande eller förbud som avses i 16 §.

 

Bestämmelserna i 28 § marknadsföringslagen (2008:486) ska då tillämpas.

 

I paragrafen ges Konsumentombudsmannen möjlighet att i fall som inte är av större vikt meddela marknadsrättsliga sanktioner. Övervägandena finns i avsnitt 5.

Paragrafen hänvisar enligt sin hittillsvarande lydelse till vissa marknadsrättsliga sanktioner i 15 §. Sistnämnda paragraf ges ett annat innehåll och innebär nu att marknadsföringslagen ska tillämpas. I förevarande paragraf hänvisas i stället till 16 §. Det innebär att Konsum- entombudsmannen får meddela föreläggande om sådant åläggande att er- bjuda personer med funktionsnedsättning eller nedsatt rörlighet transport som avses i 16 § första stycket. Vidare ges Konsumentombudsmannen samma möjlighet när det gäller sådant förbud mot diskriminering vid tillgång till passagerar- och fraktpriser som avses i 16 § andra stycket. Bestämmelsen är, på samma sätt som 28 § marknadsföringslagen, begränsad till fall som inte är av större vikt, dvs. klara fall som inte har principiellt intresse eller rör åtgärder av stor praktisk räckvidd (jfr prop. 1970:57 s. 84 f.).

Bestämmelserna i 28 § marknadsföringslagen ska tillämpas på ett föreläggande enligt förevarande paragraf. Den närmare innebörden av detta framgår av kommentaren till förslaget till 6 § lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerar- förordningar.

9.7Övriga lagförslag med anknytning till tåg-, fartygs- och busspassagerarförordningarna

Tåg-, fartygs- och busspassagerarförordningarna är i vissa fall tillämpliga i stället för lagar på området. Av EU-rätten följer att domstolar och andra myndigheter i medlemsstaterna är skyldiga att tillämpa förordningarna med företräde framför nationell rätt. Några särskilda bestämmelser om detta krävs inte. För att underlätta tillämpningen kompletteras dock de berörda lagarna med paragrafer som hänvisar till respektive EU- förordning.

51

L 315/14

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

EUROPAPARLAMENTETS OCH RÅDETS FÖRORDNING (EG) nr 1371/2007

av den 23 oktober 2007

om rättigheter och skyldigheter för tågresenärer

EUROPAPARLAMENTET OCH EUROPEISKA UNIONENS RÅD HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om upprättandet av Europeiska gemenskapen, särskilt artikel 71.1,

med beaktande av kommissionens förslag,

med beaktande av Europeiska ekonomiska och sociala kommit- téns yttrande (1),

med beaktande av Regionkommitténs yttrande (2),

i enlighet med förfarandet i artikel 251 i fördraget, på grundval av det gemensamma utkast som förlikningskommittén godkände den 31 juli 2007 (3), och

av följande skäl:

(1)Inom ramen för den gemensamma transportpolitiken är det viktigt att slå vakt om rättigheterna för tågresenärerna och att förbättra kvaliteten och effektiviteten hos person- trafiken för att bidra till en ökning av järnvägstransportens andel i förhållande till andra transportsätt.

(2)I kommissionens meddelande ”En strategi för konsument- politik 2002–2006” (4) fastställs målsättningen att uppnå en hög konsumentskyddsnivå på transportområdet i enlig- het med artikel 153.2 i fördraget.

(3)Eftersomtågresenärenärtransportavtaletssvagarepartbör man slå vakt om resenärens rättigheter.

(4)Tågresenärernas rättigheter omfattar rätt till information om tjänsten före och under resan. Järnvägsföretag och biljettutfärdarebörimöjligastemånlämnadennainforma- tion i förväg och så tidigt som möjligt.

(5)Mer detaljerade krav på tillhandahållandet av reseinforma- tion kommer att anges i de tekniska specifikationer för driftskompatibilitet (TSD) som avses i Europaparlamentets

(1) EUT C 221, 8.9.2005, s. 8. (2) EUT C 71, 22.3.2005, s. 26.

(3) Europaparlamentets yttrande av den 28 september 2005 (EUT C 227 E, 21.9.2006, s. 490), rådets gemensamma ståndpunkt av den 24 juli 2006 (EUT C 289 E, 28.11.2006, s. 1), Europaparlamen- tets ståndpunkt av den 18 januari 2007 (ännu ej offentliggjord i EUT), Europaparlamentetslagstiftningsresolutionavden25september2007 och rådets beslut av den 26 september 2007.

(4) EGT C 137, 8.6.2002, s. 2.

och rådets direktiv 2001/16/EG av den 19 mars 2001 om driftskompatibiliteten hos järnvägssystemet för konventio- nella tåg (5).

(6)En förstärkning av rättigheterna för tågresenärer bör bygga påbefintligainternationellarättsregleridettasammanhang enligt bihang A – enhetliga rättsregler för avtal om inter- nationell transport av resande på järnväg (CIV) till fördra- get om internationell järnvägstrafik (Cotif) av den 9 maj 1980, ändrat genom protokollet om ändring av fördraget om internationell järnvägstrafik av den 3 juni 1999 (Vilni- usprotokollet). Det är emellertid önskvärt att utvidga tillämpningsområdet för denna förordning till att skydda inte endast resenärer i internationell, utan också i inhemsk järnvägstrafik.

(7)Järnvägsföretagen bör samarbeta för att göra det lättare för tågresenärer att övergå från en operatör till en annan genom att när så är möjligt tillhandahålla direktbiljetter.

(8)Tillhandahållandet av information och biljetter till tågrese- närerbörunderlättasgenomattdatoriseradesystemanpas- sas till en gemensam specifikation.

(9)Det vidare införandet av reseinformations- och boknings- system bör ske i enlighet med TSD.

(10)Persontrafiken på järnväg bör gagna allmänheten. Perso- nermedfunktionshinderellernedsattrörlighet,oavsettom orsaken härtill är handikapp, ålder eller andra faktorer, bör därför ha möjligheter att resa med tåg som kan jämföras med andra medborgares. Personer med funktionshinder eller nedsatt rörlighet har samma rätt som alla andra med- borgare till fri rörlighet, valfrihet och icke-diskriminering. Särskild uppmärksamhet bör ägnas bland annat åt att informera personer med funktionshinder eller nedsatt rör- lighet om deras möjligheter att utnyttja järnvägsförbindel- serna, förutsättningarna för att kunna ta sig in och ut ur vagnarna och om vilka hjälpmedel som finns ombord på tågen.Förattlämnaresenärermedsensoriskfunktionsned- sättning bästa möjliga information om förseningar bör visuella och hörbara system användas. Personer med funk- tionshinder eller nedsatt rörlighet bör ges möjlighet att utan extra kostnad köpa biljett ombord på tåget.

(5) EGT L 110, 20.4.2001, s. 1. Direktivet senast ändrat genom kommis- sionens direktiv 2007/32/EG (EUT L 141, 2.6.2007, s. 63).

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/15

 

 

 

 

(11)Järnvägsföretag och stationsförvaltare bör ta hänsyn till personer med funktionshinder eller nedsatt rörlighet genom att uppfylla de TSD för personer med nedsatt rör- lighet för att på så sätt, i enlighet med den gällande gemen- skapslagstiftningen om offentlig upphandling, garantera tillgänglighet till alla byggnader och all rullande materiel genom att stegvis avskaffa de fysiska och funktionella hin- dren i samband med nyanskaffningar, anläggningsarbeten eller betydande renoveringar.

(12)Järnvägsföretag bör ha skyldighet att vara försäkrade eller vidta likvärdiga åtgärder så att de vid en olyckshändelse kan infria sitt skadeståndsansvar gentemot tågresenärer. Minimiförsäkringsbeloppet för järnvägsföretag bör ses över senare.

(13)Förstärkt rätt till ersättning och assistans vid försening, missad anslutning eller inställd förbindelse torde medföra incitament för persontrafikmarknaden till gagn för resenärerna.

(14)Det är önskvärt att det genom denna förordning upprättas ett system för ersättning till resenärerna vid förseningar kopplat till järnvägsföretagets ansvar, på samma grund som det internationella system som föreskrivs i Cotif, sär- skilt i bihang CIV till detta om resenärernas rättigheter.

(15)När en medlemsstat beviljar järnvägsföretag dispens från bestämmelserna i denna förordning, bör den uppmana järnvägsföretagen att, i samråd med organisationer som företräder resenärerna, införa ett system för ersättning och hjälp i händelse av allvarliga avbrott i persontrafiken.

(16)Det är också önskvärt att befria olycksoffer och deras anhöriga från omedelbara ekonomiska problem under perioden direkt efter en olycka.

(17)Detäravintresseförtågresenärerattlämpligaåtgärdervid- tas med de offentliga myndigheternas samtycke för att garantera resenärernas personliga säkerhet på järnvägssta- tionerna och ombord på tågen.

(18)Tågresenärer bör kunna framföra klagomål mot varje järn- vägsföretag som berörs när det gäller rättigheter och skyl- digheter enligt denna förordning och ha rätt att få svar inom rimlig tid.

(19)Järnvägsföretag bör fastställa, förvalta och övervaka tjäns- tekvalitetsnormer för persontrafik på järnväg.

(20)Innehållet i denna förordning bör ses över med avseende på anpassning av de finansiella beloppen till inflationen, med avseende på kraven på information och tjänstekvali- tet med hänsyn till marknadsutvecklingen samt med hän- syn till förordningens inverkan på tjänstekvaliteten.

(21)Denna förordning bör inte påverka tillämpningen av Europaparlamentets och rådets direktiv 95/46/EG av den 24 oktober 1995 om skydd för enskilda personer med avseende på behandling av personuppgifter och om det fria flödet av sådana uppgifter (1).

(22)Medlemsstaterna bör fastställa påföljder vid överträdelser av bestämmelserna i denna förordning samt se till att påföljderna tillämpas. Påföljderna, som bland annat kan innefatta ersättning till den berörda personen, bör vara effektiva, proportionerliga och avskräckande.

(23)Eftersom målen med förordningen, nämligen att utveckla gemenskapens järnvägar och införa vissa rättigheter för tågresenärer, inte i tillräcklig utsträckning kan uppnås av medlemsstaterna och de därför bättre kan uppnås på gemenskapsnivå, kan gemenskapen vidta åtgärder i enlig-

het med subsidiaritetsprincipen i artikel 5 i fördraget. I enlighet med proportionalitetsprincipen i samma artikel gårförordningeninteutövervadsom ärnödvändigtföratt uppnå dessa mål.

(24)Ett syfte med denna förordning är att förbättra persontra- fiken på järnväg inom gemenskapen. Medlemsstaterna bör därför kunna bevilja dispenser för transporter i regioner därenbetydandedelavtrafikenskerutanförgemenskapen.

(25)Järnvägsföretagivissamedlemsstaterkommermöjligenatt finna det svårt att tillämpa samtliga bestämmelser i denna förordningnärdenträderikraft.Medlemsstaternabördär- för kunna bevilja tillfällig dispens från tillämpningen av bestämmelserna i denna förordning för nationell fjärrtra- fik. Den tillfälliga dispensen bör emellertid inte avse de bestämmelser i denna förordning som ger personer med funktionshinder eller nedsatt rörlighet möjlighet att resa med tåg, inte heller rätten för dem som så önskar att köpa tågbiljett utan otillbörlig svårighet, och heller inte de bestämmelser som gäller järnvägsföretagens skadestånds- ansvar gentemot resenärerna och med avseende på deras resgods, kravet att järnvägsföretag måste vara rimligt för- säkrade samt kravet att dessa företag måste vidta lämpliga åtgärder för att garantera resenärernas personliga säkerhet på tågstationer och på tåg och hantera risker.

(1) EGT L 281, 23.11.1995, s. 31. Direktivet ändrat genom förordning (EG) nr 1882/2003 (EUT L 284, 31.10.2003, s. 1).

L 315/16

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

(26)Stads-, förorts- och regionaltrafik för passagerare skiljer sig från fjärrtrafik. Med undantag av vissa bestämmelser som bör tillämpas på all persontrafik på järnväg inom hela gemenskapen, bör medlemsstaterna därför kunna bevilja dispens från tillämpningen av bestämmelserna i denna för- ordning för stads-, förorts- och regiontrafik.

(27)Deåtgärdersomkrävsförattgenomföradennaförordning börantasienlighetmedrådetsbeslut1999/468/EGavden 28 juni 1999 om de förfaranden som skall tillämpas vid utövandet av kommissionens genomförandebefogen- heter (1).

(28)Kommissionen bör särskilt ges behörighet att anta genom- förandeåtgärder. Eftersom dessa åtgärder har en allmän räckvidd och avser att ändra icke väsentliga delar av denna förordning eller komplettera denna genom tillägg av nya icke väsentliga delar, bör de antas i enlighet med det före- skrivande förfarandet med kontroll i artikel 5a i beslut 1999/468/EG.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

KAPITEL I

ALLMÄNNA BESTÄMMELSER

Artikel 1

Syfte

I denna förordning fastställs regler på följande områden:

a)Den information som järnvägsföretagen ska tillhandahålla, ingående av transportavtal, utfärdande av biljetter och infö- rande av ett datoriserat informations- och bokningssystem för järnvägstransporter.

b)Järnvägsföretagens skadeståndsansvar och deras försäkrings- skyldigheter för resenärerna och deras resgods.

c)Järnvägsföretagens skyldigheter mot resenärerna vid förseningar.

d)Skydd av och assistans till personer med funktionshinder eller nedsatt rörlighet vid tågresor.

e)Fastställandeochövervakningavtjänstekvalitetsnormer,han- tering av risker för resenärernas personliga säkerhet och handläggning av klagomål.

f)Allmänna regler om kontroll av efterlevnaden.

(1) EGT L 184, 17.7.1999, s. 23. Beslutet ändrat genom beslut 2006/512/EG (EUT L 200, 22.7.2006, s. 11).

Artikel 2

Tillämpningsområde

1.Denna förordning ska gälla alla tågresor och järnvägstjäns- ter i hela gemenskapen som tillhandahålls av ett eller flera järn- vägsföretag med tillstånd i enlighet med rådets direktiv 95/18/EG av den 19 juni 1995 om tillstånd för järnvägsföretag (2).

2.Denna förordning är inte tillämplig på järnvägsföretag och transporttjänster som saknar tillstånd enligt direktiv 95/18/EG.

3.När denna förordning träder i kraft ska artiklarna 9, 11, 12, 19, 20.1 och 26 tillämpas på all persontrafik i hela gemenskapen.

4.Med undantag av de bestämmelser som anges i punkt 3 får en medlemsstat på klara, tydliga och icke-diskriminerande grun- der under en tid av högst 5 år bevilja dispens, som får förnyas två gånger med högst 5 år vid varje tillfälle, för inhemsk persontrafik från tillämpningen av bestämmelserna i denna förordning.

5.Med undantag av de bestämmelser som anges i punkt 3 i denna artikel får en medlemsstat undanta stads- och förortsper- sontrafik samt regional persontrafik från tillämpningen av bestämmelserna i denna förordning. När det gäller att skilja mel- lan stads- och förortspersontrafik, å ena sidan, och regional persontrafik, å andra sidan, ska medlemsstaterna tillämpa defini- tionerna i rådets direktiv 91/440/EEG av den 29 juli 1991 om utvecklingenavgemenskapensjärnvägar (3).Vidtillämpningenav dessadefinitionerskamedlemsstaternaanvändaföljandekriterier: avstånd, tjänsternas frekvens, antalet uppehåll enligt tidtabell, rul- lande materiel, biljettsystem, skillnad i antalet passagerare under högtrafik och lågtrafik, tågtyper och tidtabeller.

6.Under en tid av högst 5 år får en medlemsstat på klara, tyd- liga och icke-diskriminerande grunder bevilja dispens, som får förnyas, från tillämpningen av bestämmelserna i denna förord- ning för särskilda tjänster eller resor av det skälet att en betydande del av persontrafiken, inbegripet minst ett stationsuppehåll enligt tidtabell, tillhandahålls utanför gemenskapen.

7.Medlemsstaterna ska underrätta kommissionen om dispens som beviljats enligt punkterna 4, 5 och 6. Kommissionen ska vidta lämpliga åtgärder, om sådan dispens inte anses förenlig med bestämmelserna i denna artikel. Senast den 3 december 2014 ska kommissionenförelägga Europaparlamentet och rådet en rapport om de dispenser som beviljats enligt punkterna 4, 5 och 6.

(2) EGT L 143, 27.6.1995, s. 70. Direktivet senast ändrat genom Europa- parlamentets och rådets direktiv 2004/49/EG (EUT L 164, 30.4.2004, s. 44).

(3) EGT L 237, 24.8.1991, s. 25. Direktivet senast ändrat genom direktiv 2006/103/EG (EUT L 363, 20.12.2006, s. 344).

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/17

 

 

 

 

Artikel 3

Definitioner

I denna förordning gäller följande definitioner:

1.järnvägsföretag: järnvägsföretag enligt definitionen i artikel 2 i direktiv 2001/14/EG (1), samt andra offentliga eller privata företag vars verksamhet består i att tillhandahålla godstran- sporter och/eller personbefordran med järnväg, med krav på att företaget ska sörja för dragkraft. Definitionen innefattar även företag som endast tillhandahåller dragkraft.

2.transportör: det järnvägsföretag med vilket resenären har ingått transportavtalet eller ett antal på varandra följande järnvägsföretag som enligt avtalet har skadeståndsansvar.

3.ställföreträdande transportör: ett järnvägsföretag som inte har ingått ett transportavtal med resenären, men till vilket det järnvägsföretag som har ingått avtalet har överlåtit en del av, eller hela, järnvägstransporten.

4.infrastrukturförvaltare: organ eller företag som särskilt ansva- rar för anläggning och underhåll av järnvägsinfrastruktur, eller en del därav, i enlighet med definitionen i artikel 3 i direktiv 91/440/EEG. Detta kan också inbegripa förvaltning av kontroll- och säkerhetssystem för infrastrukturen. Infra- strukturförvaltarens uppgifter i ett järnvägsnät eller en del av ett nät kan tilldelas olika organ eller företag.

5.stationsförvaltare: en organisatorisk enhet i en medlemsstat som har givits ansvaret för förvaltningen av en järnvägssta- tion. Infrastrukturförvaltaren kan vara stationsförvaltare.

6.researrangör: en arrangör eller återförsäljare, annan än järn- vägsföretaget,idenbemärkelsesomavsesiartikel2.2och2.3 i direktiv 90/314/EEG (2).

7.biljettutfärdare: varje återförsäljare av järnvägstransporter som ingår transportavtal och säljer biljetter för ett järnvägsföre- tags eller för egen räkning.

8.transportavtal:ettavtalomtransportmotersättningellerkost- nadsfritt mellan ett järnvägsföretag eller en biljettutfärdare och resenären om tillhandahållande av en eller flera transporttjänster.

9.bokning: ett tillstånd på papper eller i elektronisk form som berättigar till transport enligt i förväg bekräftade och person- ligt utformade transportarrangemang.

(1) Europaparlamentets och rådets direktiv 2001/14/EG av den 26 februari 2001 om tilldelning av infrastrukturkapacitet, uttag av avgifterförutnyttjandeavjärnvägsinfrastruktur(EGTL75,15.3.2001, s. 29). Direktivet senast ändrat genom direktiv 2004/49/EG.

(2) Rådets direktiv 90/314/EEG av den 13 juni 1990 om paketresor, semesterpaket och andra paketarrangemang (EGT L 158, 23.6.1990, s. 59).

10.direktbiljett:enbiljettellerbiljettersomrepresenteraretttrans- portavtal som har ingåtts för att genomföra på varandra föl- jande järnvägstjänster som tillhandahålls av ett eller flera järnvägsföretag.

11.nationell förbindelse: en tjänst för personbefordran med järn- väg som inte korsar en medlemsstatsgräns.

12.försening: tidsskillnaden mellan den tidpunkt då resenären planerades anlända enligt den offentliggjorda tidtabellen och hans eller hennes verkliga eller förväntade ankomsttid.

13.periodkort eller abonnemang: en biljett för ett obegränsat antal resor som ger den behörige innehavaren rätt att resa med tåg på en särskild resrutt eller ett särskilt nätverk under en angi- ven period.

14.datoriserat informations- och bokningssystem för järnvägstrafik (CIRSRT): ett datoriserat system med information om järn- vägsförbindelser som erbjuds av järnvägsföretag. Detta sys- tem ska omfatta följande information om persontrafiken:

a)Scheman och tidtabeller för persontrafiken.

b)Platstillgången på persontåg.

c)Biljettpriser och särskilda villkor.

d)Hur tågen kan utnyttjas av personer med nedsatt rörlighet.

e)Olika möjligheter att göra bokningar eller utfärda biljet- ter eller direktbiljetter, i den utsträckning vissa av eller samtligadessamöjligheterärtillgängligaföranvändarna.

15.person med funktionshinder eller person med nedsatt rörlighet: en person vars rörlighet är nedsatt vid användning av transpor- ter på grund av någon form av fysiskt funktionshinder (sen- soriskt eller motoriskt, bestående eller tillfälligt), psykiskt funktionshinder eller psykisk störning eller ålder och vars situation kräver lämplig uppmärksamhet och anpassning till hans eller hennes särskilda behov av de tjänster som är tillgängliga för alla passagerare.

16.allmänna villkor för befordran: Transportföretagets villkor i form av i varje medlemsstat gällande allmänna villkor eller tariffer som genom ingående av transportavtalet har kommit att utgöra en integrerad del av detta.

17.fordon: motorfordon eller släpvagn som transporteras vid personbefordran.

L 315/18

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

KAPITEL II

TRANSPORTAVTAL, INFORMATION OCH BILJETTER

Artikel 4

Transportavtal

3. Den information som avses i punkterna 1 och 2 ska lämnas i den mest lämpliga formen. Särskild hänsyn ska därvid tas till personer med nedsatt syn eller hörsel.

Artikel 9

Tillgång till biljetter, direktbiljetter och bokningar

Ingående och genomförande av transportavtal och tillhandahål- lande av information och biljetter ska ske enligt bestämmelserna i avdelning II och avdelning III i bilaga I, varvid bestämmelserna i detta kapitel ska iakttas.

Artikel 5

Cyklar

Järnvägsföretagen ska ge resenärerna möjlighet att ta med cyklar på tåget – om så är lämpligt, mot ersättning – om de är lätthan- terliga, om det inte har någon negativ effekt på trafiktjänsten i fråga och om vagnarna tillåter.

Artikel 6

Förbud mot att frångå och begränsa förpliktelserna

1.Förpliktelser gentemot resenärerna enligt denna förordning får inte begränsas eller frångås, till exempel genom ett undantag eller en begränsande klausul i transportavtalet.

2.Ett järnvägsföretag får erbjuda avtalsvillkor som är förmån- ligareförresenärenändevillkorsomfastställsidennaförordning.

Artikel 7

Skyldighet att informera om att en trafiktjänst upphör

Järnvägsföretagen eller, i tillämpliga fall, behöriga myndigheter som är ansvariga för kontrakt om allmän järnvägstrafik, ska på lämpligt sätt, och innan besluten genomförs, offentliggöra beslut om att dra in tjänster.

Artikel 8

Reseinformation

1.Järnvägsföretag och biljettutfärdare som erbjuder transport- avtal för ett eller flera järnvägsföretags räkning ska på begäran, utan att bestämmelserna i artikel 10 påverkas, ge resenären åtminstone den information som avses i del I av bilaga II om de resor för vilka ett transportavtal erbjuds av det berörda järnvägs- företaget. Biljettutfärdare som erbjuder transportavtal för egen räkning, och researrangörer, ska lämna denna information om den finns tillgänglig.

2.Järnvägsföretagen ska under resan lämna resenären åtmins- tone den information som avses i del II av bilaga II.

1.Järnvägsföretag och biljettutfärdare ska erbjuda biljetter, direktbiljetter och bokningar när sådana finns att tillgå.

2.Utan att tillämpningen av punkt 4 påverkas ska järnvägsfö- retagen distribuera biljetter till resenärerna via åtminstone ett av följande försäljningsställen:

a)Biljettkontor eller biljettautomater.

b)Telefon, Internet eller via annan allmänt tillgänglig informationsteknik.

c)Ombord på tågen.

3. Utan att tillämpningen av punkterna 4 och 5 påverkas ska järnvägsföretagen för tjänster som tillhandahålls enligt avtal om offentliga tjänster distribuera biljetter via åtminstone ett av föl- jande försäljningsställen:

a)Biljettkontor eller biljettautomater.

b)Ombord på tågen.

4.Järnvägsföretagen ska erbjuda möjlighet att erhålla biljetter för respektive förbindelse ombord på tåget om inte detta begrän- sas eller vägras av säkerhetsskäl, enligt en policy mot bedrägerier, på grund av obligatorisk platsbokning eller på skäliga kommersi- ella grunder.

5.Om det inte finns något biljettkontor eller någon biljett- automat på avgångsstationen ska resenärerna på järnvägsstatio- nen informeras om:

a)möjligheten att köpa biljett per telefon, via Internet eller på tåget samt hur detta ska göras,

b)den närmaste järnvägsstation eller plats där det finns biljett- kontor och/eller biljettautomater.

Artikel 10

Reseinformation och bokningssystem

1. För att lämna den information och utfärda de biljetter som avses i denna förordning ska järnvägsföretag och biljettutfärdare använda ett datoriserat informations- och bokningssystem för järnvägstrafik (CIRSRT) som ska upprättas enligt de förfaranden som avses i denna artikel.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/19

 

 

 

 

2.De tekniska specifikationer för driftskompatibilitet (TSD) som avses i direktiv 2001/16/EG ska tillämpas inom ramen för denna förordning.

3.Kommissionen ska på förslag av Europeiska järnvägsbyrån (ERA)antaTSDförtelematikapplikationersomingåriservicentill passagerarna senast den 3 december 2010 TSD ska göra det möj- ligtatt lämna den information som avses ibilaga II och att utfärda biljetter i enlighet med denna förordning.

4.Järnvägsföretagenskaanpassasitt CIRSRTienlighetmed de krav som anges i TSD och enligt en införandeplan som anges i denna TSD.

5.I enlighet med bestämmelserna i direktiv 95/46/EG får järn- vägsföretag eller biljettutfärdare inte lämna ut personanknuten informationomenskildabokningartillandrajärnvägsföretageller biljettutfärdare.

KAPITEL III

JÄRNVÄGSFÖRETAGENS SKADESTÅNDSANSVAR GENTEMOT RESENÄRERNA OCH MED AVSEENDE PÅ DERAS RESGODS

Artikel 11

Skadeståndsansvar för resenärer och resgods

Utan att tillämplig nationell lagstiftning som ger resenärerna ytterligare ersättning för skador påverkas ska järnvägsföretagens skadeståndsansvar gentemot resenärerna och med avseende på deras resgods regleras genom kapitel I, III och IV i avdelning IV, VI och VII i bilaga I, varvid bestämmelserna i detta kapitel ska följas.

Artikel 12

Försäkring

1.Den försäkringsskyldighet som avses i artikel 9 i direktiv 95/18/EG ska, när det gäller skadeståndsansvar gentemot resenä- rer, förstås som ett krav på att järnvägsföretagen ska vara försäk- rade till en sådan nivå, eller vidta likvärdiga åtgärder, så att de kan infria sitt skadeståndsansvar enligt denna förordning.

2.Kommissionen ska senast den 3 december 2010 förelägga Europaparlamentet och rådet en rapport om fastställande av den lägsta försäkringsnivån för järnvägsföretag. Om så är lämpligt ska rapporten åtföljas av lämpliga förslag eller rekommendationer.

Artikel 13

Förskottsutbetalningar

1. Om en resenär avlider eller skadas ska järnvägsföretaget som avses i artikel 26.5 i bilaga I omgående, och under inga omständigheter senare än femton dagar efter det att den ersätt- ningsberättigadefysiska personensidentitetharfastställts,göra de förskottsutbetalningar som behövs för att täcka omedelbara eko- nomiska behov, i proportion till den skada som lidits.

2.Vid dödsfall ska förskottsutbetalningen uppgå till minst

21000 EUR, utan att tillämpningen av punkt 1 därför påverkas.

3.En förskottsutbetalning ska inte innebära ett erkännande av skadeståndsansvar och kan kvittas mot eventuella senare utbetal- ningar enligt denna förordning, men den kan inte återkrävas annat än i de fall skadan uppstått genom resenärens försumlighet eller vållande, eller när en annan person än den ersättningsberät- tigade personen har mottagit förskottsutbetalningen.

Artikel 14

Bestridande av skadeståndsansvar

Ävenomjärnvägsföretagetbestriderattdetharskadeståndsansvar för kroppsskada som en resenär som färdas med företagets tåg har åsamkats, ska det göra varje rimlig ansträngning för att hjälpa en resenär som begär skadestånd från tredje part.

KAPITEL IV

FÖRSENING, UTEBLIVEN ANSLUTNING OCH INSTÄLLELSE

Artikel 15

Skadeståndsansvar vid förseningar, utebliven anslutning och inställelse

Järnvägsföretagens skadeståndsansvar när det gäller försening, utebliven anslutning och inställelse ska regleras genom kapitel II i avdelning IV i bilaga I, varvid bestämmelserna i detta kapitel ska iakttas.

Artikel 16

Ersättning och ombokning

Om det skäligen är troligt att ankomsten till den slutliga bestäm- melseorten enligt transportavtalet kommer att försenas mer är 60 minuter, ska resenären omedelbart erbjudas att välja något av följande:

a)Ersättning motsvarande hela biljettpriset, enligt samma vill- kor som vid köpet, för den eller de delar av resan som inte fullföljts och för den eller de delar som fullföljts, om resan blivit meningslös med tanke på resenärens ursprungliga res- plan,medenreturresatilldenförstaavreseortensnarastmöj- ligt om detta är relevant. Denna ersättning ska betalas ut på samma villkor som den ersättning som avses i artikel 17.

b)Fortsatt resa eller ombokning till den slutliga bestämmelse- orten snarast möjligt och på likvärdiga transportvillkor.

c)Fortsatt resa eller ombokning till den slutliga bestämmelse- orten en senare dag som resenären finner lämplig och på lik- värdiga transportvillkor.

L 315/20

 

SV

 

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

 

 

 

 

 

Artikel 17

 

Artikel 18

 

Ersättning av biljettpriset

 

Assistans

1. Resenärer som drabbas av en försening mellan den avrese- och ankomstort som anges på biljetten för vilken biljettpriset inte har ersatts i enlighet med artikel 16, får, utan att därmed avsäga sig rätten till transport, begära ersättning för en sådan försening från järnvägsföretaget. Den minsta ersättningen vid förseningar ska vara

a)25 % av biljettpriset vid 60–119 minuters försening,

b)50 % av biljettpriset vid 120 minuters försening eller mer.

Resenärer som har ett periodkort eller abonnemang och som under dess giltighetstid upprepade gånger har drabbats av förse- ningar eller inställd trafik får begära lämplig ersättning i enlighet med järnvägsföretagens ersättningsbestämmelser. Dessa bestäm- melserskaangekriterierna förattdefinieraförseningarochföratt beräkna ersättningen.

Ersättningen för förseningar ska beräknas i proportion till det pris som resenären faktiskt erlagt för den försenade tjänsten.

När transportavtalet avser en ut- och återresa ska ersättningen för försening under antingen ut- eller återresan beräknas i proportion till halva det pris som erlagts för biljetten. Priset för en försenad förbindelse enligt varje annan form av transportavtal som omfat- tar flera påföljande delsträckor ska på samma sätt beräknas i pro- portion till hela priset.

Vid beräkning av förseningstiden ska hänsyn inte tas till en för- sening om järnvägsföretaget kan ge belägg för att denna har inträffat utanför de territorier där fördraget om upprättandet av Europeiska gemenskapen är tillämpligt.

2.Ersättningen av biljettpriset ska erläggas inom en månad efter begäran om ersättning. Ersättningen får erläggas i form av värdebevis och/eller andra tjänster om villkoren är flexibla (sär- skiltvadgällergiltighetstidoch bestämmelseort).Ersättningenska på resenärens begäran betalas kontant.

3.Ersättningen av biljettpriset får inte minskas genom avdrag för transaktionskostnader, till exempel avgifter, telefon- eller por- tokostnader. Järnvägsföretagen får fastställa en lägsta gräns under vilken ingen ersättning ska utgå. Denna gräns får inte överskrida 4 EUR.

4.Resenären ska inte vara berättigad till ersättning om han eller hon har informerats om en försening före inköp av biljetten eller om ankomsttiden har försenats med mindre än 60 minuter genom fortsatt resa med en annan trafiktjänst eller ombokning.

1.Vid försenad ankomst eller avgång ska järnvägsföretaget eller stationsförvaltaren hålla resenärerna informerade om situa- tionen och om förväntad avgångs- och ankomsttid så snart dessa uppgifter finns att tillgå.

2.Vid varje försening som avses i punkt 1 och överstiger

60minuter ska resenärerna dessutom kostnadsfritt erbjudas

a)måltider och förfriskningar, om dessa finns att tillgå ombord på tåget eller på stationen eller rimligen kan anskaffas, som står i skälig proportion till väntetiden,

b)hotellrum eller annan inkvartering, samt transport mellan järnvägsstationen och inkvarteringsplatsen, när ett uppehåll på en eller fler nätter, eller ett ytterligare uppehåll blir nöd- vändigt, där och om detta är fysiskt möjligt,

c)transport från tåget till järnvägsstationen, till en alternativ avgångspunkt eller till den slutliga bestämmelseorten för för- bindelsen om tåget har blivit stående på linjen, där och om detta är fysiskt möjligt.

3.Om förbindelsen måste avbrytas ska järnvägsföretagen så snart som möjligt organisera alternativ befordran av resenärerna.

4.Järnvägsföretagen ska på resenärens begäran intyga på bil- jetten att tågtrafiken varit försenad, att förseningen lett till en mis- sad anslutning eller att förbindelsen har ställts in.

5.Det järnvägsföretag som genomför trafiken ska vid tillämp- ningen av punkterna 1, 2 och 3 fästa särskild uppmärksamhet vid behoven hos personer med funktionshinder eller nedsatt rörlig- het och eventuella medföljande personer.

KAPITEL V

PERSONER MED FUNKTIONSHINDER ELLER NEDSATT

RÖRLIGHET

Artikel 19

Rätten till transport

1. Järnvägsföretag och stationsförvaltare ska, med aktivt delta- gande av organisationer som företräder personer med funktions- hinder eller nedsatt rörlighet, ha eller fastställa icke- diskriminerande regler för befordran av personer med funktionshinder eller nedsatt rörlighet.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/21

 

 

 

 

2. Personer med funktionshinder eller nedsatt rörlighet ska utan extra kostnad erbjudas bokningar och biljetter. Järnvägsfö- retag, biljettutfärdare eller researrangörer får inte vägra att godta en bokning av eller att utfärda en biljett till en person med funk- tionshinder eller nedsatt rörlighet, eller kräva att en sådan person åtföljsavenannanperson,utomnärdettaärstriktnödvändigtför att uppfylla de regler för befordran som avses i punkt 1.

Artikel 20

Information till personer med funktionshinder eller nedsatt rörlighet

1.Järnvägsföretaget, biljettutfärdaren eller researrangören ska på begäran informera personer med funktionshinder eller nedsatt rörlighet om tågtrafiktjänsternas tillgänglighet och om förutsätt- ningarna för att kunna ta sig in i och ut ur vagnarna i enlighet med reglerna för befordran i artikel 19.1 samt informera perso- ner med funktionshindereller nedsatt rörlighet om vilka hjälpme- del som finns ombord på tågen.

2.Ett järnvägsföretag, en biljettutfärdare och/eller en resear- rangör som använder sig av undantaget enligt artikel 19.2 ska på begäranskriftligtinformeradenberördapersonenmedfunktions- hinder eller nedsatt rörlighet om sina skäl härtill inom fem arbets- dagar från det att bokning eller utfärdande av biljett nekats eller krav om åtföljande person framförts.

Artikel 21

Tillgänglighet

1.Järnvägsföretag och stationsförvaltare ska, i överensstäm- melse med TSD för personer med nedsatt rörlighet, se till att sta- tioner, perronger, rullande materiel och andra inrättningar är tillgängliga för personer med funktionshinder eller nedsatt rörlighet.

2.Om det saknas personal som kan fungera som ledsagare ombord på tågen eller personal vid stationen ska järnvägsföretag och stationsförvaltare göra varje rimlig ansträngning för att per- soner med funktionshinder eller nedsatt rörlighet ska ha möjlig- het att resa med tåg.

Artikel 22

Assistans på järnvägsstationer

1. Stationsförvaltaren ska vid avresa från, tågbyte vid eller ankomst till en bemannad järnvägsstation lämna personer med funktionshinder eller nedsatt rörlighet kostnadsfri assistans, så att de kan stiga på avgående tåg, byta till anslutande tåg eller stiga av ett ankommande tåg till vilket de köpt biljett, utan att tillämp- ningen av reglerna för utnyttjande enligt artikel 19.1 därför påverkas.

2.Medlemsstaterna får bevilja undantag från punkt 1 för per- soner som utnyttjar förbindelser inom ramen för ett avtal om allmänna tjänster som tilldelats i enlighet med gemenskapslag- stiftningen, under förutsättning att den behöriga myndigheten tillhandahåller arrangemang med likvärdig eller bättre tillgång till transporttjänster.

3.När det gäller obemannade stationer ska järnvägsföretaget och stationsförvaltaren se till att lätt tillgänglig information i enlighet med reglerna för befordran i artikel 19.1 visas beträf- fande närbelägna, bemannade stationer och omedelbart tillgäng- lig assistans för personer med funktionshinder eller nedsatt rörlighet.

Artikel 23

Assistans ombord på tågen

Utan att tillämpningen av de regler för befordran som avses i arti- kel 19.1 påverkas ska ett järnvägsföretag lämna en person med funktionshinder eller nedsatt rörlighet kostnadsfri assistans ombord på tågen samt vid påstigning och avstigning.

Vid tillämpningen av denna artikel ska assistans ombord på tågen innebära att varje rimlig ansträngning görs för att erbjuda assis- tans till en person med funktionshinder eller nedsatt rörlighet för attgetillgångtillsammatjänsterombordpåtågetsomövrigapas- sagerare, om denna persons funktionshinder eller rörlighetsned- sättning hindrar honom eller henne från att oberoende och tryggt utnyttja dessa tjänster.

Artikel 24

Villkor för assistans

Järnvägsföretag, stationsförvaltare, biljettutfärdare och resear- rangörer ska samarbeta för att lämna assistans till personer med nedsatt rörlighet enligt artiklarna 22 och 23 i enlighet med följande:

a)Assistansen ska lämnas under förutsättning att det järnvägs- företag, den stationsförvaltare, den biljettutfärdare eller den researrangörbiljettenköptshosminst48timmarinnanassis- tansen erfordras har meddelats att personen behöver sådan assistans. Om biljetten avser flera resor ska ett meddelande varatillräckligt,underförutsättningatttillräckliginformation lämnas om tidpunkten för påföljande resor.

b)Järnvägsföretag, stationsförvaltare, biljettutfärdare och rese- arrangörer skavidtade åtgärder som erfordras för atttaemot dessa meddelanden.

c)Om inget meddelande i enlighet med led a lämnas, ska järn- vägsföretaget och stationsförvaltaren i all rimlig utsträckning lämna den assistans som erfordras för att personen med funktionshinderellernedsattrörlighetskakunnaföretaresan.

L 315/22

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

d)Stationsförvaltaren ska, utan att andras förfoganderätt över områden utanför järnvägsstationen åsidosätts, utse platser inom och utanför järnvägsstationen där personer med ned- satt rörlighet kan anmäla sin ankomst till järnvägsstationen och, om så behövs, begära assistans.

e)Assistansenskalämnasunderförutsättningattpersonenmed funktionshinder eller nedsatt rörlighet infinner sig på utsedd plats vid den tidpunkt som avtalats med det järnvägsföretag ellerdenstationsförvaltaresomlämnarassistansen.Denavta- ladetidpunktenfårliggahögst60minuterföreoffentliggjord avgångstid,ellerföredentidpunktdåsamtligaresenärerupp- manats att checka in. Om det inte finns någon föreskriven tidpunkt vid vilken personen med funktionshinder eller ned- satt rörlighet ska infinna sig, ska personen i fråga infinna sig på den utsedda platsen senast 30 minuter före offentliggjord avgångstid,ellerföredentidpunktdåsamtligaresenärerupp- manats att checka in.

Artikel 25

Ersättning för rörlighetshjälpmedel eller annan särskild utrustning

Om järnvägsföretaget är skadeståndsskyldigt för förlust, helt eller delvis, eller skada på rörlighetshjälpmedel eller annan särskild utrustning som används av personer med funktionshinder eller nedsatt rörlighet, får ingen finansiell begränsning tillämpas.

KAPITEL VI

SÄKERHET, KLAGOMÅL OCH TJÄNSTEKVALITET

Artikel 26

Resenärernas personliga säkerhet

Järnvägsföretag, infrastrukturförvaltare och stationsförvaltare ska i samförstånd med de offentliga myndigheterna vidta lämpliga åtgärderinomsinarespektiveansvarsområden,ochanpassaåtgär- derna till den säkerhetsnivå som fastställs av dessa myndigheter, för att säkerställa resenärernas personliga säkerhet på järnvägssta- tioner och ombord på tågen och för att hantera risker. De ska samarbeta och utbyta information om de bästa metoderna för att förebyggahandlingarsomsannoliktkanförsämrasäkerhetsnivån.

Artikel 27

Klagomål

1. Järnvägsföretagen ska inrätta ett system för att hantera kla- gomål i samband med de rättigheter och skyldigheter som anges i denna förordning. Järnvägsföretaget ska se till att resenärerna får kännedom om hur järnvägsföretaget ska kontaktas och om dess arbetsspråk.

2.Resenärernafårframföraklagomåltillvilketsomhelstavde berördajärnvägsföretagen.Mottagarenavklagomåletskainomen månad antingen avge ett motiverat svar eller, när så är berättigat, informera resenären om vid vilken tidpunkt inom mindre än tre månaderfråndetattklagomåletframfördesettsvarkanförväntas.

3.Järnvägsföretaget ska i den årliga rapport som avses i arti- kel 28 ange hur många och vilka typer av klagomål som har mot- tagits och handlagts, den genomsnittliga handläggningstiden och eventuella förbättringsåtgärder som har vidtagits.

Artikel 28

Kvalitetsnormer

1.Järnvägsföretagen ska fastställa tjänstekvalitetsnormer och införa ett system för kvalitetsstyrning för att upprätthålla tjänste- kvaliteten. Kvalitetsnormerna ska åtminstone omfatta de punkter som anges i bilaga III.

2.Järnvägsföretagenskaföljasinverksamhetmotbakgrundav kvalitetsnormerna. Järnvägsföretagen ska varje år, tillsammans med årsrapporten, offentliggöra en rapport om kvaliteten på sina tjänster.Rapporternaomtjänsternaskvalitetskaoffentliggöraspå järnvägsföretagens webbplats på Internet. Dessa rapporter ska dessutom offentliggöras på Europeiska järnvägsbyråns webbplats.

KAPITEL VII

INFORMATION OCH KONTROLL AV EFTERLEVNAD

Artikel 29

Information till resenärerna om deras rättigheter

1.Järnvägsföretag, stationsförvaltare och researrangörer ska, när de säljer tågbiljetter, informera resenärerna om de rättigheter och skyldigheter som de har enligt denna förordning. För att upp- fylla denna informationsskyldighet får järnvägsföretag, stations- förvaltare och researrangörer använda en sammanfattning av bestämmelserna i denna förordning, som ställs till deras förfo- gande och som utarbetas av kommissionen på samtliga officiella språk vid Europeiska unionens institutioner.

2.Järnvägsföretagoch stationsförvaltareskainformeraresenä- rerna på stationen och i tåget på ett lämpligt sätt om kontaktupp- gifterna för det organ som medlemsstaterna utsett enligt artikel 30.

Artikel 30

Kontroll av efterlevnad

1. Varje medlemsstat ska utse ett eller flera tillsynsorgan som ska ansvara för att denna förordning efterlevs. Varje organ ska vidta de åtgärder som behövs för att säkerställa att resenärernas rättigheter respekteras.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/23

 

 

 

 

Varje organ ska i fråga om sin organisation, sina finansieringsbe- slut, sin rättsliga struktur och sitt beslutsfattande vara oberoende av infrastrukturförvaltare, tilldelningsorgan och järnvägsföretag.

Medlemsstaterna ska underrätta kommissionen om vilket eller vilka organ som har utsetts enligt denna punkt och om deras res- pektive uppgifter.

2. Resenärerna får rikta klagomål om de överträdelser av denna förordning som hävdas av dem till det organ som utsetts enligt punkt 1, eller till andra lämpliga organ som utsetts av en medlemsstat.

Artikel 31

Samarbete mellan tillsynsorganen

För att kunna samordna beslutsprinciperna i hela gemenskapen ska de tillsynsorgan som avses i artikel 30 utbyta information om sitt arbete, sina beslutsprinciper och sin beslutspraxis. Kommis- sionen ska stödja tillsynsorganen i detta arbete.

KAPITEL VIII

SLUTBESTÄMMELSER

Artikel 32

Påföljder

Artikel 34

Ändringsbestämmelser

1.Deåtgärdersomavserattändraickeväsentligadelaridenna förordning genom att komplettera den, och som krävs för att genomföra artiklarna 2, 10 och 12 ska antas i enlighet med det föreskrivande förfarande med kontroll som avses i artikel 35.2.

2.Deåtgärdersomavserattändraickeväsentligadelaridenna förordning genom att inflationsanpassa de finansiella belopp som anges i den, med undantag för beloppen i bilaga I, ska antas i enlighetmeddetföreskrivandeförfarandemedkontrollsomavses i artikel 35.2.

Artikel 35

Kommittéförfarande

1.Kommissionen ska biträdas av den kommitté som inrättats genom artikel 11a i direktiv 91/440/EEG.

2.När det hänvisas till denna punkt ska artiklarna 5a.1–5a.4 och 7 i beslut 1999/468/EG tillämpas, med beaktande av bestäm- melserna i artikel 8 i det beslutet.

Artikel 36

Rapport

Medlemsstaterna ska fastställa reglerna för påföljder vid överträ- delse av bestämmelserna i denna förordning och vidta de åtgär- der som är nödvändiga för att se till att bestämmelserna följs. De påföljder som fastställs ska vara effektiva, proportionerliga och avskräckande.Medlemsstaternaskaanmäladessareglerochåtgär- der till kommissionen senast den 3 juni 2010 och ska utan dröjs- mål anmäla varje senare ändring av dem.

Artikel 33

Bilagor

De åtgärder som avser att ändra icke väsentliga delar i denna för- ordning genom att anpassa dess bilagor, utom bilaga I, ska antas i enlighet med det föreskrivande förfarande med kontroll som avses i artikel 35.2.

Kommissionen ska överlämna en rapport, som i synnerhet berör tjänsternas kvalitetsnormer, till Europaparlamentet och rådet om genomförandet och resultaten av denna förordning senast den 3 december 2012.

Rapporten ska grunda sig på den information som ska lämnas enligt denna förordning och enligt artikel 10b i direktiv 91/440/EG. Rapporten ska vid behov åtföljas av lämpliga förslag.

Artikel 37

Ikraftträdande

Denna förordning träder i kraft 24 månader efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Strasbourg den 23 oktober 2007.

På Europaparlamentets vägnar

På rådets vägnar

H.-G. PÖTTERING

M. LOBO ANTUNES

Ordförande

 

Ordförande

 

 

 

L 315/24

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

BILAGA I

Utdrag ur enhetliga rättsregler för avtal om internationell transport av resande på järnväg (CIV)

Bihang A

till fördraget om internationell järnvägstrafik (COTIF) av den 9 maj 1980, ändrat genom protokollet om ändring av fördraget om internationell järnvägstrafik av den 3 juni 1999

AVDELNING II

INGÅENDE OCH FULLGÖRANDE AV TRANSPORTAVTALET

Artikel 6

Transportavtal

1.Genom transportavtalet förbinder sig transportören att transporteraresande och i förekommande fall resgods och for- don till bestämmelseorten och att lämna ut resgodset och fordonen på bestämmelsestationen.

2.Transportavtalet ska bekräftas genom en eller flera biljetter utfärdade till den resande. Om biljetten saknas, är felaktig eller har gått förlorad ska detta, om inte annat följer av artikel 9, dock inte påverka avtalets bestånd eller giltighet, utan det ska fortfarande lyda under dessa enhetliga rättsregler.

3.Biljetten ska tills motsatsen bevisats gälla som bevis för ingåendet av och innehållet i transportavtalet.

Artikel 7

Biljett

1.De allmänna transportvillkoren ska avgöra biljetternas form och innehåll samt det språk och de skrivtecken som ska användas när de trycks och fylls i.

2.Biljetten ska innehålla åtminstone följande uppgifter:

a)Transportören eller transportörerna.

b)En uppgift om att dessa enhetliga rättsregler ska tillämpas på transporten, utan hinder av eventuella klausuler med mot- satt innebörd. Detta får anges genom förkortningen CIV.

c)Alla andra nödvändiga uppgifter som styrker ingåendet av och innehållet i transportavtalet och som gör det möjligt för den resande att hävda sina rättigheter enligt avtalet.

3.När den resande tar emot biljetten ska han förvissa sig om att den stämmer med de uppgifter som han har lämnat.

4.Biljetten ska kunna överlåtas om den inte är utställd på en namngiven person och resan inte har börjat.

5.Biljetten får upprättas i elektronisk form som kan omvandlas till läsbara skrivtecken. Förfarandena för registrering och behandling av uppgifterna ska vara likvärdiga i funktionshänseende, i synnerhet i fråga om bevisvärdet hos den biljett som dessa uppgifter utgör.

Artikel 8

Betalning och återbetalning av transportavgift

1.Om inte annat överenskommits mellan den resande och transportören ska transportavgiften betalas i förväg.

2.De allmänna transportvillkoren ska avgöra under vilka omständigheter transportavgiften ska återbetalas.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/25

 

 

 

 

Artikel 9

Rätt till transport – Förlust av rätten till transport

1. Den resande ska från resans början vara försedd med en giltig biljett och visa upp den vid biljettkontrollen. I de all- männa transportvillkoren får föreskrivas

a)att en resande som inte visar upp en giltig biljett ska betala en tilläggsavgift utöver transportavgiften,

b)att en resande som vägrar att genast betala transportavgiften eller tilläggsavgiften kan förlora rätten till transport,

c)om och under vilka omständigheter tilläggsavgiften ska återbetalas.

2.I de allmänna transportvillkoren får föreskrivas att resande som

a)utgör en fara för tågtrafikens säkerhet och funktion eller för andra resandes säkerhet, eller

b)stör andra resande på ett sätt som inte kan godtas,

ska förlora rätten till transport eller tvingas avbryta sin resa, och att sådana personer inte har rätt att få tillbaka vare sig trans- portavgiften eller den avgift de har betalat för transporten av inskrivet resgods.

Artikel 10

Fullgörande av förvaltningsmyndigheters föreskrifter

Den resande är skyldig att följa de föreskrifter som meddelas av tullmyndigheter eller andra förvaltningsmyndigheter.

Artikel 11

Tåginställelse och tågförsening – Utebliven tåganslutning

Transportören ska i förekommande fall på biljetten intyga att tåget har ställts in eller tåganslutningen uteblivit.

AVDELNING III

TRANSPORT AV HANDRESGODS, DJUR, INSKRIVET RESGODS OCH FORDON

Kapitel I

Allmänna bestämmelser

Artikel 12

Rätt att medföra föremål och djur

1.Den resande får medföra föremål somlätt kan bäras (handresgods) samt levandedjur i enlighet medde allmänna trans- portvillkoren. Dessutom får den resande medföra skrymmande föremål i enlighet med de särskilda bestämmelserna i de all- männa transportvillkoren. Föremål och djur som kan medföra obehag eller besvär för de resande eller orsaka skada får inte medföras som handresgods.

2.Den resande får sända föremål och djur som inskrivet resgods i enlighet med de allmänna transportvillkoren.

3.Transportören får tillåta transport av fordon i samband med transport av resande i enlighet med de särskilda bestäm- melserna i de allmänna transportvillkoren.

4.Transport av farligt gods som handresgods, inskrivet resgods samt i eller på fordon som enligt denna avdelning trans- porteras på järnväg ska ske i enlighet med Reglementet om internationell järnvägstransport av farligt gods (RID).

L 315/26

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

Artikel 13

Undersökning

1.Om det finns grundad anledning att misstänka att villkoren för transporten inte är uppfyllda ska transportören ha rätt att undersöka om de föremål (handresgods, inskrivet resgods, fordon och deras last) och djur som medförs uppfyller trans- portvillkoren, såvida inte lagar och bestämmelser i den stat där undersökningen ska utföras förbjuder detta. Den resande ska erbjudas att närvara vid undersökningen. Om denne inte infinner sig eller inte kan nås ska transportören tillkalla två obe- roende vittnen.

2.Om det fastställs att villkoren för transporten inte är uppfyllda kan transportören kräva att den resande betalar kost- naderna för undersökningen.

Artikel 14

Fullgörande av förvaltningsmyndigheters föreskrifter

Den resande är skyldig att följa de föreskrifter som meddelas av tullmyndigheter eller andra förvaltningsmyndigheter när han under transport medför föremål (handresgods, inskrivet resgods, fordon och deras last) och djur. Han ska vara närva- rande vid undersökningen av dessa föremål om inte undantag medges i tillämpliga nationella bestämmelser.

Kapitel II

Handresgods och djur

Artikel 15

Uppsikt

Den resande ska ha ansvaret för att hålla uppsikt över det handresgods och de djur han medför.

Kapitel III

Inskrivet resgods

Artikel 16

Inlämning av inskrivet resgods

1.Deavtalsenligaskyldigheternaifrågaomtransportavinskrivetresgodsskabekräftasgenomettresgodsbevissomutfär- das till den resande.

2.Om resgodsbeviset saknas, är felaktigt eller har gått förlorat ska detta, om inte annat följer av artikel 22, dock inte påverkabeståndellergiltighetifrågaomdeavtalsomrörtransportavdetinskrivnaresgodset,utandeskafortfarandeomfat- tas av dessa enhetliga rättsregler.

3.Resgodsbeviset ska tills motsatsen bevisats gälla som bevis för inskrivningen av resgodset och villkoren för dess transport.

4.Tills motsatsen bevisats ska det antas att det inskrivna resgodset var i gott yttre skick när transportören övertog det och att antalet kollin och deras vikt stämmer med uppgifterna på resgodsbeviset.

Artikel 17

Resgodsbevis

1.De allmänna transportvillkoren ska avgöra resgodsbevisets form och innehåll samt det språk och de skrivtecken som ska användas när de trycks och fylls i. Artikel 7.5 ska också tillämpas här.

2.Resgodsbeviset ska innehålla åtminstone följande uppgifter:

a)Transportören eller transportörerna.

b)En uppgift om att dessa enhetliga rättsregler ska tillämpas på transporten, utan hinder av eventuella klausuler med mot- satt innebörd. Detta får anges genom förkortningen CIV.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/27

 

 

 

 

c)Alla andra nödvändiga uppgifter som styrker ingåendet av och innehållet i transportavtalet och som gör det möjligt för den resande att hävda sina rättigheter enligt avtalet.

3.Närdenresandetaremotresgodsbevisetskahanförvissasigomattdetstämmermeddeuppgiftersomhanharlämnat.

Artikel 18

Inskrivning och transport

1.Om inte undantag medges i de allmänna transportvillkoren, ska resgods endast skrivas in mot uppvisande av en biljett som gäller minst till resgodsets bestämmelseort. I övrigt ska inskrivningen ske i enlighet med de föreskrifter som gäller på inlämningsplatsen.

2.När det i de allmänna transportvillkoren anges att resgods får tas emot för transport utan att biljett visas upp, ska dessa enhetliga rättsregler i den del som avser den resandes rättigheter och skyldigheter i fråga om inskrivet resgods också gälla för den som lämnat in resgodset.

3.Transportören kan sända inskrivet resgods med ett annat tåg eller ett annat transportmedel och via en annan befor- dringsväg än den som den resande tagit.

Artikel 19

Betalning av transportavgift för inskrivet resgods

Om inte annat överenskommits mellan den resande och transportören ska transportkostnaden för inskrivet resgods betalas vid inskrivningen.

Artikel 20

Märkning av inskrivet resgods

Den resande ska märka varje kolli på väl synlig plats och på ett tillräckligt hållbart och läsbart sätt ange

a)namn och adress,

b)bestämmelseorten.

Artikel 21

Rätt att förfoga över inskrivet resgods

1.Omomständigheternamedgerochomdetintestridermotdeföreskriftersommeddelatsavtullmyndigheterellerandra förvaltningsmyndigheter kan den resande begära att återfå sitt inskrivna resgods på inlämningsplatsen mot överlämnande av resgodsbeviset och, om det krävs i de allmänna transportvillkoren, mot uppvisande av biljetten.

2.De allmänna transportvillkoren får innehålla andra bestämmelser om rätten att förfoga över inskrivet resgods, särskilt om ändring av bestämmelseorten och de eventuella kostnaderna för den resande.

Artikel 22

Utlämning

1. Inskrivet resgods ska lämnas ut mot att resgodsbeviset lämnas tillbaka och att eventuella kostnader för sändningen betalas.

Transportören ska ha rätt men inte skyldighet att undersöka om innehavaren av resgodsbeviset har rätt att få ut resgodset.

2. Med utlämning till resgodsbevisets innehavare jämställs följande åtgärder, om de är i enlighet med de föreskrifter som gäller på bestämmelseorten:

a)Överlämnande av resgodset till en tull- eller skattemyndighet i en tjänste- eller lagerlokal som används av myndigheten och som inte står under transportörens uppsikt.

b)Överlämnande av levande djur till tredje man för förvaring.

L 315/28

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

3.Innehavaren av resgodsbeviset får begära att resgodset lämnas ut på bestämmelseorten så snart den överenskomna tiden, och i förekommande fall den tid som krävs för tullmyndigheters och andra förvaltningsmyndigheters behandling av resgodset, har löpt ut.

4.Om resgodsbeviset inte lämnas tillbaka behöver transportören inte lämna ut resgodset till någon annan än den som styrker sin rätt till godset. Vid otillräckliga bevis får transportören fordra att säkerhet ställs.

5.Resgodset ska lämnas ut på den bestämmelseort som angivits vid inskrivningen.

6.Om innehavaren av resgodsbeviset inte får resgodset utlämnat har han rätt att få ett intygande på resgodsbeviset om den dag och det klockslag då han begärde utlämning enligt punkt 3.

7.Den som har rätt till resgodset får vägra att ta emot detta om transportören inte uppfyller hans begäran om att det ska undersökas för att fastställa om en påstådd skada föreligger.

8.I övrigt ska utlämningen av resgodset ske enligt de bestämmelser som gäller på bestämmelseorten.

Kapitel IV

Fordon

Artikel 23

Villkor för transport

I de särskilda bestämmelser om transport av fordon som ingår i de allmänna transportvillkoren ska särskilt anges vilka vill- kor som gäller vid mottagande för transport, inskrivning, lastning, transport, lossning och utlämning samt den resandes skyldigheter.

Artikel 24

Transportdokument

1.De avtalsenliga skyldigheterna i fråga om transport av fordon ska bekräftas genom ett transportdokument som utfär- das till den resande. Transportdokumentet kan utgöra en del av den resandes biljett.

2.De särskilda bestämmelser om transport av fordon som ingår i de allmänna transportvillkoren ska avgöra transport- dokumentets form och innehåll samt det språk och de skrivtecken som ska användas när det trycks och fylls i. Artikel 7.5 ska också tillämpas här.

3.Transportdokumentet ska innehålla åtminstone följande uppgifter:

a)Transportören eller transportörerna.

b)En uppgift om att dessa enhetliga rättsregler ska tillämpas på transporten, utan hinder av eventuella klausuler med mot- satt innebörd. Detta får anges genom förkortningen CIV.

c)Allaandranödvändigauppgiftersomstyrkerdeavtalsenligaskyldigheternaenligttransportavtaletochsomgördetmöj- ligt för den resande att hävda sina rättigheter enligt avtalet.

4. När den resande tar emot transportdokumentet ska han förvissa sig om attdet stämmer med de uppgifter som han har lämnat.

Artikel 25

Tillämplig rätt

Om inte annat följer av bestämmelserna i detta kapitel ska bestämmelserna i kapitel III om transport av inskrivet resgods vara tillämpliga på fordon.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/29

 

 

 

 

AVDELNING IV

TRANSPORTÖRENS ANSVAR

Kapitel I

Ansvar i fall då resande dödas eller skadas

Artikel 26

Förutsättningar för ansvar

1.Transportören ska vara ansvarig för skada som uppkommer till följd av att resande dödas eller tillfogas personskada eller annan fysisk eller psykisk skada genom en olyckshändelse som har samband med järnvägsdriften och som inträffar medan den resande uppehåller sig i ett järnvägsfordon eller stiger på eller av ett sådant fordon, oavsett vilken järnvägsin- frastruktur som använts.

2.Transportören ska vara fri från detta ansvar

a)om olyckshändelsen har orsakats av omständligheter som inte kan hänföras till själva järnvägsdriften och som trans- portören inte hade kunnat undgå eller förebygga följderna av, även om transportören hade iakttagit den omsorg som omständigheterna påkallade,

b)i den utsträckning som olyckshändelsen beror på fel eller försummelse av den resande,

c)om olyckshändelsen beror på ett sådant beteende av tredje man som transportören inte hade kunnat undgå eller före- bygga följderna av, även om transportören hade iakttagit den omsorg som omständigheterna påkallade. Ett annat före- tag som använder samma infrastruktur ska inte anses som tredje man. Rätten till återkrav mot tredje man ska inte påverkas.

3.Om olyckshändelsen beror på ett beteende från tredje man och om transportören trots detta inte helt befrias från ansvar enligt punkt 2 c, ska transportören svara för hela skadan inom de gränser som anges i dessa enhetliga rättsregler men utan inskränkning av den rätt till återkrav som transportören kan ha mot tredje man.

4.Dessa enhetliga rättsregler ska inte inverka på det ansvar som kan åvila transportören i andra fall än de som avses i punkt 1.

5.Om en transport som omfattas av ett enda transportavtal utförsav efterföljande transportörer ska den transportör som det enligt transportavtalet åligger att utföra transporten på den del där olyckshändelsen inträffade vara ansvarig om en resande dödas eller skadas. Om denna transport inte har utförts av transportören utan av en faktisk transportör ska bägge transportörerna vara solidariskt ansvariga i enlighet med dessa enhetliga rättsregler.

Artikel 27

Ersättning vid dödsfall

1.Om en resande dödas ska ersättningen omfatta

a)de nödvändiga kostnader som föranleds av dödsfallet, särskilt kostnaderna för transport av liket och begravningskostnaderna,

b)om döden inte har inträffat omedelbart, de ersättningsposter som anges i artikel 28.

2. Om den resandes död medför att en person, mot vilken den avlidne var eller i framtiden skulle ha blivit underhålls- skyldig enligt lag, förlorar sitt underhåll ska ersättning också lämnas för denna förlust. I fråga om ersättningskrav från en person som den avlidne åtagit sig att underhålla utan att vara förpliktad till det enligt lag ska nationell rätt tillämpas.

Artikel 28

Ersättning vid personskada

Om en resande tillfogas personskada eller annan fysisk eller psykisk skada ska ersättningen täcka

a)nödvändiga kostnader, särskilt kostnaderna för vård och transport,

b)inkomstförlust till följd av förlorad eller nedsatt arbetsförmåga och ökning av levnadskostnaderna.

L 315/30

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

Artikel 29

Ersättning vid annan personskada

Om och i vilken mån transportören är skyldig att betala ersättning för andra personskador än sådana som avses i artik- larna 27 och 28 ska avgöras enligt nationell rätt.

Artikel 30

Ersättningens form och storlek vid dödsfall eller personskada

1.Den ersättning som avses i artikel 27.2 och artikel 28 b ska utges som engångsbelopp. Ersättningen ska dock utges som livränta om den nationella rätten tillåter det och den resande som har lidit skadan eller den ersättningsberättigade enligt artikel 27.2 begär det.

2.Storleken på den ersättning som ska utges enligt punkt 1 ska bestämmas enligt nationell rätt. Vid tillämpningen av dessa enhetliga rättsregler ska dock ett engångsbelopp, eller livränta motsvarande detta belopp, fastställas till högst

175000 beräkningsenheter per resande, om det i den nationella rätten föreskrivs ett lägre maximibelopp.

Artikel 31

Andra transportmedel

1.Utom i de fall som avses i punkt 2 ska bestämmelserna om transportörens ansvar i fall då resande dödas eller skadas inte vara tillämpliga på skada som uppkommit under den del av transporten som enligt transportavtalet inte utgjorde järnvägstransport.

2.Om ett järnvägsfordon transporteras med färja ska dock bestämmelserna i fall då resande dödas eller skadas vara tillämpliga på skada som avses i artikel 26.1 och artikel 33.1, som orsakasav en olyckshändelse som har samband med järn- vägsdriften och som inträffar medan den resande uppehåller sig i järnvägsfordonet eller stiger på eller av detta fordon.

3.Om järnvägsdriften till följd av exceptionella omständigheter är tillfälligt avbruten och de resande transporteras med ett annat transportmedel, ska transportören vara ansvarig enligt dessa enhetliga rättsregler.

Kapitel II

Ansvar när tidtabellen inte hålls

Artikel 32

Ansvar vid tåginställelse, tågförsening eller utebliven tåganslutning

1.Transportören ska vara ansvarig gentemot den resande för skada som uppkommer på grund av att tåginställelse, tåg- försening eller utebliven tåganslutning medför att resan inte kan fortsättas samma dag eller att en fortsatt resa samma dag på grund av omständigheterna inte rimligen kan begäras. Ersättningen ska täcka rimliga kostnader för kost och logi liksom också rimliga kostnader som orsakas av behovet att underrätta personer som väntar på den resande.

2.Transportören ska vara fri från detta ansvar när inställelsen, förseningen eller den uteblivna anslutningen kan hänföras till följande orsaker:

a)Omständigheter som inte är förbundna med järnvägsdriften och som transportören inte hade kunnat undgå eller före- bygga följderna av, även om transportören hade iakttagit den omsorg som omständigheterna påkallade.

b)Fel eller försummelse av den resande.

c)Tredje mans beteende som transportören inte hade kunnat undgå eller förebygga följderna av även om transportören hade iakttagit den omsorg som omständigheterna påkallade. Ett annat företag som använder samma infrastruktur ska inte anses som tredje man. Rätten till återkrav mot tredje man ska inte påverkas.

3. Om och i vilken mån transportören är skyldig att betala ersättning för annan skada än sådan som avses i punkt 1 ska avgöras enligt nationell rätt. Denna bestämmelse ska inte påverka tillämpningen av artikel 44.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/31

 

 

 

 

Kapitel III

Ansvar i fråga om handresgods, djur, inskrivet resgods och fordon

AVSNITT 1

Handresgods och djur

Artikel 33

Ansvar

1.Om en resande dödas eller skadas ska transportören dessutom vara ansvarig för skada som uppkommer till följd av fullständig eller partiell förlust av eller skada på ett föremål som den resande hade på sig eller medförde som handresgods. Detta ska också gälla för djur som den resande tagit med sig. Artikel 26 ska också tillämpas här.

2.I övrigt ska transportören inte vara ansvarig för skada som uppkommer till följd av fullständig eller partiell förlust av eller skada på föremål, handresgods eller djur som det enligt artikel 15 åligger den resande att hålla uppsikt över, om inte förlusten eller skadan orsakats genom transportörens fel eller försummelse. De övriga artiklarna i avdelning IV, utom arti- kel 51, och avdelning VI ska inte vara tillämpliga i detta fall.

Artikel 34

Begränsning av ersättningen vid förlust av föremål eller sakskada

Om transportören är ansvarig enligt artikel 33 1 ska transportören ersätta den uppkomna skadan upp till ett belopp om 1 400 beräkningsenheter per resande.

Artikel 35

Ansvarsbefrielse

Transportören ska vara fri från ansvar gentemot den resande för skada som uppstår som en följd av att den resande inte följer de föreskrifter som meddelas av tullmyndigheter eller andra förvaltningsmyndigheter.

AVSNITT 2

Inskrivet resgods

Artikel 36

Förutsättningar för ansvar

1.Transportören ska vara ansvarig för skada som uppkommer till följd av att det inskrivna resgodset går helt eller delvis förlorat eller skadas under tiden från det att resgodset tas emot för transport till dess att det lämnas ut samt för dröjsmål med utlämningen.

2.Transportören ska vara fri från detta ansvar om förlusten, skadan eller dröjsmålet med utlämningen beror på fel eller försummelse av den resande, på en anvisning som den resande har lämnat och som inte har föranletts av fel eller försum- melse från transportörens sida, på fel i själva resgodset eller på omständigheter som transportören inte hade kunnat undgå eller förebygga följderna av.

3.Transportören ska vara fri från detta ansvar om förlusten eller skadan härrör från en sådan särskild risk som är för- bunden med ett eller flera av följande förhållanden:

a)Avsaknad av förpackning eller bristfällig förpackning.

b)Resgodsets särskilda beskaffenhet.

c)Inlämning av föremål som inte transporteras som inskrivet resgods.

Artikel 37

Bevisskyldighet

1. Detär transportörens sakatt visaattförlusten,skadan ellerdröjsmålet harorsakatsavettsådantförhållandesom anges i artikel 36.2.

L 315/32

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

2. Om transportören visar att förlusten eller skadan med hänsyn till de föreliggande omständigheterna kan vara en följd av en eller flera av de särskilda risker som anges i artikel 36.3, ska det antas att så är fallet. Den som har rätt till ersättning får dock visa att förlusten eller skadan inte alls eller inte uteslutande är en följd av en sådan risk.

Artikel 38

Efterföljande transportörer

När en transport som omfattas av ett enda transportavtal utförs av flera efterföljande transportörer blir varje transportör i och med mottagandet av resgodset med resgodsbeviset eller fordonet med transportdokumentet part i avtalet, såvitt avser transport av resgodset eller fordonet, i enlighet med villkoren i resgodsbeviset eller transportdokumentet och tar på sig de skyldigheter som följer av detta. I ett sådant fall ska varje transportör vara ansvarig för transporten hela vägen intill utlämningen.

Artikel 39

Faktisk transportör

1.När en transportör helt eller delvis har anförtrott transporten till en faktisk transportör, oavsett om detta sker i enlig- het med en möjlighet som medges i transportavtalet eller ej, ska transportören vara ansvarig för hela transporten.

2.Alla bestämmelser i dessa enhetliga rättsregler som rör transportörens ansvar ska även tillämpas på den faktiska trans- portörensansvarfördentransportdenneutför.Artiklarna48och52skatillämpasnärtalanförsmotdeanställdaellerandra personer vilkas tjänster den faktiska transportören anlitar för att utföra transporten.

3.Särskildaöverenskommelsergenomvilkatransportörenåtarsigförpliktelsersomintekrävsenligtdessaenhetligarätts- regler eller avstår från rättigheter som följer av dessa enhetliga rättsregler ska inte gälla gentemot en faktisk transportör som inte uttryckligen och skriftligen har godtagit dem. Oavsett om den faktiska transportören har godtagit en överenskommelse eller ej ska transportören vara bunden av de skyldigheter eller avståenden som följer av den.

4.När och i den mån både transportören och den faktiska transportören är ansvariga ska ansvaret vara solidariskt.

5.Det sammanlagda ersättningsbelopp som ska betalas av transportören eller den faktiska transportören samt deras anställda eller andra personer vilkas tjänster de anlitar för att utföra transporten, ska inte överskrida de gränser som anges i dessa enhetliga rättsregler.

6.Denna artikel ska inte påverka den rätt till återkrav som kan föreligga mellan transportören och den faktiska transportören.

Artikel 40

Antagande att resgods har gått förlorat

1.Utan att behöva lägga fram ytterligare bevisning får den som har rätt till godset anse att ett resgodskolli gått förlorat om det inte har lämnats ut eller hållits tillgängligt för honom inom 14 dagar från det att det begärdes utlämnat enligt artikel 22.3.

2.Om ett resgodskolli som har ansetts förlorat kommer till rätta inom ett år från det att det begärdes utlämnat ska trans- portören underrätta den som har rätt till godset, om hans adress är känd eller kan utrönas.

3.Inom 30 dagar från det att den som har rätt till godset har fått den underrättelse som avses i punkt 2 får han begära att kollit lämnas ut till honom. I ett sådant fall är han skyldig att betala kostnaderna för kollits transport från inlämnings- platsen till den plats där utlämningen sker och att betala tillbaka den ersättning som han har fått, i förekommande fall med avdrag för de kostnader som kan ha räknats in i ersättningen. Han ska dock behålla rätten till ersättning för dröjsmål med utlämningen enligt artikel 43.

4.Om utlämning av ett kolli som kommit till rätta inte begärs inom den tid som anges i punkt 3 eller om ett kolli kom- mer till rätta senare än ett år efter det att utlämning begärdes, får transportören förfoga över kollit enligt de bestämmelser som gäller på den plats där det finns.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/33

 

 

 

 

Artikel 41

Ersättning vid förlust

1. När inskrivet resgods gått helt eller delvis förlorat ska transportören inte vara skyldig att betala någon annan ersätt- ning än

a)om skadans storlek är visad, en ersättning som motsvarar skadan, dock högst 80 beräkningsenheter per kilogram av förlusten i bruttovikt eller 1 200 beräkningsenheter per kolli,

b)om skadans storlek inte är visad, en ersättning med sammanlagt 20 beräkningsenheter per kilogram av förlusten i brut- tovikt eller 300 beräkningsenheter per kolli.

I de allmänna transportvillkoren ska bestämmas om ersättningen ska beräknas per kilogram av viktförlusten eller per kolli.

2. Transportören ska vidare betala tillbaka avgiften för resgodstransport och övriga utlägg i samband med transport av det kolli som gått förlorat liksom även redan erlagda tullavgifter och punktskatter.

Artikel 42

Ersättning vid skada

1.När inskrivet resgods har skadats ska transportören betala ersättning motsvarande minskningen av resgodsets värde, men inget ytterligare skadestånd.

2.Ersättningen ska inte överstiga följande belopp:

a)Om allt resgodset har minskat i värde till följd av skadan, det belopp som skulle ha betalats om resgodset hade gått förlorat.

b)Om endast en del av resgodset har minskat i värde till följd av skadan, det belopp som skulle ha betalats om denna del hade gått förlorad.

Artikel 43

Ersättning vid dröjsmål med utlämningen

1. Viddröjsmålmedutlämningenavinskrivetresgodsskatransportörenförvarjepåbörjad24-timmarsperiodräknatfrån den tidpunkt då resgodset begärdes utlämnat, dock högst för 14 dagar, betala ersättning enligt följande:

a)Om den som har rätt till godset visar att skada, varmed förstås även skada på själva resgodset, har uppkommit genom dröjsmålet, betalas en ersättning som motsvarar skadan upp till högst 0,80 beräkningsenheter per kilogram av brut- tovikten av det för sent utlämnade resgodset, eller 14 beräkningsenheter för varje kolli.

b)Om den som har rätt till godset inte visar att skada har uppkommit genom dröjsmålet, betalas en ersättning på sam- manlagt 0,14 beräkningsenheter per kilogram av bruttovikten av det för sent utlämnade resgodset, eller 2,80 beräk- ningsenheter för varje kolli.

I de allmänna transportvillkoren ska det fastställas om ersättningen ska beräknas per kilogram eller per kolli.

2.Om resgodset har gått helt förlorat ska ersättning enligt punkt 1 inte betalas utöver ersättningen enligt artikel 41.

3.Om en del av resgodset har gått förlorad ska ersättning enligt punkt 1 endast betalas för den del som inte gått förlorad.

4.Om skadan på resgodset inte har orsakats av dröjsmålet med utlämningen kan ersättning enligt punkt 1 i förekom- mande fall betalas utöver ersättningen enligt artikel 42.

5.Den sammanlagda ersättningen enligt punkt 1 och artiklarna 41 och 42 ska inte i något fall överstiga den ersättning som skulle ha betalats om resgodset hade gått helt förlorat.

L 315/34

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

AVSNITT 3

Fordon

Artikel 44

Ersättning vid försening

1.Om lastningen av ett fordon blir försenad till följd av en omständighet som kan hänföras till transportören eller om utlämningen av fordonet blir fördröjd ska transportören, om den som har rätt till fordonet visar att det inträffade har med- fört skada, ersätta skadan upp till det belopp som motsvarar transportavgiften.

2.Om den som har rätt till fordonet häver transportavtalet på grund av att lastning inte sker i rätt tid till följd av en omständighet som kan hänföras till transportören, ska transportavgiften betalas tillbaka till honom. Om han visar att han lidit skada genom dröjsmålet får han dessutom kräva ersättning upp till det belopp som motsvarar transportavgiften.

Artikel 45

Ersättning vid förlust

Om ett fordon går helt eller delvis förlorat ska ersättningen för visad skada till den som har rätt till fordonet beräknas efter fordonets bruksvärde. Den ska dock inte överstiga 8 000 beräkningsenheter. Ett släpfordon med eller utan last ska betraktas som ett särskilt fordon.

Artikel 46

Ansvar i fråga om andra föremål

1.I fråga om föremål som har lämnats i fordonet eller är placerade i bagageutrymmen (t.ex. bagage- eller skidboxar) som är fast monterade, ska transportören endast vara ansvarig för sådan skada som transportören har orsakat genom fel eller försummelse. Den sammanlagda ersättningen ska inte överstiga 1 400 beräkningsenheter.

2.I fråga om föremål som har spänts fast på utsidan av fordonet inbegripet de bagageutrymmen som avses i punkt 1 ska transportören vara ansvarig för sådan skada endast om det visas att skadan orsakats genom handling eller underlåtenhet antingen i avsikt att vålla en sådan skada eller hänsynslöst och med insikt att en sådan skada sannolikt skulle uppkomma.

Artikel 47

Tillämplig rätt

Om inte annat sägs i detta avsnitt, ska bestämmelserna i avsnitt 2 om ansvarför inskrivet resgods vara tillämpliga på fordon.

Kapitel IV

Allmänna bestämmelser

Artikel 48

Förlust av rätt att åberopa begränsning av skadeståndsansvar

De begränsningar av skadeståndsansvaret som föreskrivs i dessa enhetliga rättsregler samt de bestämmelser i nationell rätt som begränsar ersättningen till ett fastställt belopp ska inte tillämpas om det visas att transportören orsakat skadan genom handling eller underlåtenhet antingen i avsikt att vålla en sådan skada eller hänsynslöst och med insikt att en sådan skada sannolikt skulle uppkomma.

Artikel 49

Omräkning och ränta

1. När beräkningen av ersättning medför omräkning av belopp i utländsk valuta ska beräkningen göras enligt kursen den dag och på den plats där ersättningen betalas.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/35

 

 

 

 

2.Den som har rätt till ersättning får kräva ränta på ersättningsbeloppet med fem procent per år från och med den dag då krav framställdes enligt artikel 55 eller, om något krav inte framställts, från och med den dag då talan väcks vid domstol.

3.På ersättning enligt artiklarna 27 och 28 ska dock ränta betalas först från och med dagen för de omständigheter som lades till grund för beräkning av ersättningsbeloppet, om denna dag är senare än den dag då kravet framställdes eller talan väcktes.

4.I fråga om inskrivet resgods ska ränta betalas endast om ersättningsbeloppet överstiger 16 beräkningsenheter per resgodsbevis.

5.Om den som har rätt till ersättning för inskrivet resgods inte inom en skälig fastställd tidsfrist till transportören över- lämnar de styrkande handlingar som krävs för att kunna slutföra behandlingen av hans krav, ska ränta inte betalas för tiden från det att tidsfristen går ut till dess att handlingarna överlämnas.

Artikel 50

Ansvar vid atomolycka

Transportören ska vara fri från det ansvar som föreskrivs i dessa enhetliga rättsregler, om skadan har orsakats av en atom- olycka, och ägaren till atomanläggningen eller någon annan i dennes ställe är ansvarig för skadan enligt en stats lagar och bestämmelser om ansvar på atomenergiområdet.

Artikel 51

Personer som transportören ansvarar för

Transportören ska vara ansvarig för sin personal och för andra personer vilkas tjänster han anlitar för utförandet av trans- porten när denna personal eller dessa andra personer handlar under fullgörande av sina uppgifter. Förvaltarna av den järn- vägsinfrastruktur på vilken transporten utförs ska anses som personer som transportören anlitar för utförandet av transporten.

Artikel 52

Andra grunder för anspråk

1.Idefalldärdessaenhetligarättsreglerärtillämpligafåranspråkpåersättning,oavsettvilkengrundsomåberopas,göras gällande mot transportören endast under de förutsättningar och med de begränsningar som föreskrivs i dessa enhetliga rättsregler.

2.Detsamma ska även gälla i fråga om anspråk mot personal och andra personer som transportören ansvarar för enligt artikel 51.

AVDELNING V

DEN RESANDES ANSVAR

Artikel 53

Särskilda principer för ansvar

Den resande ska vara ansvarig gentemot transportören för sådana skador

a)som uppstår till följd av att den resande underlåtit att fullgöra sina skyldigheter enligt

1.artiklarna 10, 14 och 20,

2.de särskilda bestämmelserna för transport av fordon som ingår i de allmänna transportvillkoren, eller

3.reglementet om internationell järnvägstransport av farligt gods (RID), eller

b)som orsakats av föremål och djur som han för med sig.

Den resande ska inte vara ansvarig gentemot transportören om han styrker att skadan orsakats av omständigheter som han inte hade kunnat undgå eller förebygga följderna av, även om han hade iakttagit den omsorg som krävs av en ansvarsmed- veten resande. Denna bestämmelse ska inte påverka transportörens ansvar enligt artiklarna 26 och 33 1.

L 315/36

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

AVDELNING VI

FRAMSTÄLLANDE AV ANSPRÅK

Artikel 54

Fastställelse av att egendom har skadats eller delvis gått förlorat

1.Omtransportörenupptäckerellerfåranledningattantaattegendom(resgods,fordon)somtransporterasgenomtrans- portörens försorg har skadats eller delvis gått förlorad, eller om den som har rätt till egendomen påstår att så är fallet, ska transportören genast och om möjligt i dennes närvaro upprätta en rapport som alltefter förlustens eller skadans art redo- visar egendomens tillstånd och så noga som möjligt anger skadans omfattning, dess orsak och tidpunkten då den inträffade.

2.En kopia av rapporten ska kostnadsfritt tillställas den som har rätt till egendomen.

3.Om den som har rätt till egendomen inte godtar uppgifterna i rapporten, kan han begära att resgodsets eller fordonets tillstånd samt skadans orsak och omfattning ska fastställas av en sakkunnig som utses av avtalsparterna eller på rättslig väg. Förfarandet ska genomföras i enlighet med lagar och bestämmelser i den stat där utredningen äger rum.

Artikel 55

Ersättningsanspråk

1.Ersättningsanspråk med anledning av transportörens ansvar i fall då resande dödas eller skadas ska framställas skrift- ligen till den transportör mot vilken talan kan väckas. Om en transport som omfattas av ett enda transportavtal genomförs av efterföljande transportörer, får anspråk även riktas mot den första eller sista transportören samt mot den transportör som har sitt huvudkontor eller den filial eller agentur som ingått transportavtalet i den stat där den resande har sitt hemvist eller är stadigvarande bosatt.

2.Andra anspråk med anledning av ett transportavtal ska vara skriftliga och ställas till den transportör som anges i arti- kel 56.2 och 56.3.

3.Handlingar som den som har rätt till ersättning önskar foga till ersättningsanspråket ska inges i original eller i kopia, som om transportören så begär ska vara styrkt. Vid slutlig uppgörelse i fråga om ett anspråk får transportören kräva att bil- jetten, resgodsbeviset och transportdokumentet lämnas tillbaka.

Artikel 56

Transportörer mot vilka talan får föras

1.Talan om ersättning i fall då resande dödas eller skadas får endast föras mot den transportör som är ansvarig enligt artikel 26.5.

2.Om inte annat anges i punkt 4 får annan talan som grundas på transportavtalet endast föras mot den första eller sista transportören eller den transportör som utförde den del av transporten under vilken den omständighet inträffade som talan grundas på.

3.I fråga om transport som utförs av efterföljande transportörer får talan föras enligt punkt 2 mot den transportör som ska lämna ut resgodset eller fordonet, om denne med sitt medgivande är inskriven i resgodsbeviset eller transportdokumen- tet, även om transportören varken har mottagit resgodset eller fordonet.

4.Talan om återbetalning av ett belopp som har betalats i enlighet med transportavtalet får föras mot den transportör som har tagit emot detta belopp eller mot den transportör för vars räkning det har tagits emot.

5.Som genkäromål eller kvittningsinvändning får talan föras mot en annan transportör än de som avses i punkterna 2 och 4, om talan grundas på samma transportavtal som huvudyrkandet i målet.

6.I den mån dessa enhetliga rättsregler ska tillämpas på den faktiska transportören, får talan föras även mot denne.

7.Omkärandenharrättattvälja mellanfleratransportörer,skahansvalrättupphöranär talanväcks mot någonavdessa; detta ska också gälla om käranden har rätt att välja mellan en eller flera transportörer och en faktisk transportör.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/37

 

 

 

 

Artikel 58

Förlust av rätten att föra talan med anledning av dödsfall eller personskada

1.Rätten till sådan talan som grundas på transportörens ansvar i fall då resande dödas eller skadas ska upphöra, om inte den som har rätt till ersättning, inom tolv månader från det att han fick kännedom om skadan lämnar meddelande om ska- defallet till någon av de transportörer hos vilka ett anspråk kanframställas enligt artikel55.1. Om den som har rätt tillersätt- ning muntligen lämnar meddelande till transportören, ska denne ge honom ett intyg om det muntliga meddelandet.

2.Talerätten ska dock inte upphöra om

a)den som har rätt till ersättning har framställt ett anspråk hos någon av de transportörer som anges i artikel 55.1, inom den tid som anges i punkt 1,

b)den ansvariga transportören på något annat sätt har fått kännedom om att en resande har skadats, inom den tid som anges i punkt 1,

c)meddelande om skadefallet inte har lämnats eller inte har lämnats i tid till följd av omständigheter som inte kan läggas den till last som har rätt till ersättning,

d)den som har rätt till ersättning visar att skadefallet har orsakats av fel eller försummelse från transportörens sida.

Artikel 59

Förlust av rätten att föra talan om transport av resgods

1.När den som har rätt till resgodset har tagit emot detta, upphör rätten att föra talan till följd av transportavtalet mot transportören med anledning av att resgodset gått delvis förlorat, blivit skadat eller lämnats ut för sent.

2.Talerätten ska dock inte upphöra

a)vid delförlust eller skada, om

1.förlusten eller skadan har fastställts enligt artikel 54 innan den som har rätt till resgodset tog emot det,

2.den fastställelse som borde ha gjorts enligt artikel 54 inte har gjorts, och detta beror enbart på fel eller försum- melse från transportörens sida,

b)vid skada som inte kan upptäckas utifrån och som fastställs först efter det att den som har rätt till resgodset tagit emot detta, om han

1.begär fastställelse enligt artikel 54 genast efter det att skadan upptäcks och senast tre dagar efter det att han tog emot resgodset, och

2.dessutom visar att skadan har uppkommit under tiden från det att resgodset togs emot av transportören till dess att det lämnades ut,

c)vid dröjsmål med utlämningen, om den som har rätt till godset inom 21 dagar har gjort sin rätt gällande hos någon av de transportörer som anges i artikel 56.3,

d)den som har rätt till godset visar att skadan har orsakats av fel eller försummelse från transportörens sida.

Artikel 60

Preskription

1.En skadeståndsfordran som grundas på transportörens ansvar i fall då resande dödas eller skadas ska preskriberas

a)för den resande, efter tre år räknat från dagen efter den dag då den skadevållande händelsen inträffade,

b)för andra som har rätt till ersättning, efter tre år räknat från dagen efter den resandes död, dock senast fem år räknat från dagen efter den dag då olyckan inträffade.

L 315/38

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

2.Andra fordringar på grund av ett transportavtal ska preskriberas efter ett år. Preskriptionstiden ska dock vara två år i fråga om en fordran som framställs på grund av en skada som transportören orsakat genom handling eller underlåtenhet antingen i avsikt att vålla en sådan skada eller hänsynslöst och med insikt att en sådan skada sannolikt skulle uppkomma.

3.Den preskriptionstid som anges i punkt 2 ska räknas i fråga om

a)fordran på ersättning för totalförlust: från fjortonde dagen efter utgången av den tid som anges i artikel 22.3;

b)fordran på ersättning för delförlust, skada eller dröjsmål med utlämningen: från dagen för utlämningen;

c)fordran som i något annat avseende rör transport av resande: från den dag då biljettens giltighetstid gick ut.

I preskriptionstiden inräknas inte den dag som anges som begynnelsedag.

4.[…]

5.[…]

6.I övrigt ska förlängning av preskriptionstiden och preskriptionsavbrott regleras enligt nationell rätt.

AVDELNING VII

TRANSPORTÖRERNAS INBÖRDES FÖRHÅLLANDEN

Artikel 61

Avräkning i fråga om transportavgiften

1.Varje transportör som har eller borde ha uppburit en transportavgift ska vara skyldig att till de berörda transportö- rerna betala de andelar som tillkommer dem. Betalningssättet ska bestämmas genom överenskommelse mellan transportörerna.

2.Artikel 6.3, artikel 16.3 och artikel 25 ska även tillämpas på förhållandena mellan efterföljande transportörer.

Artikel 62

Rätt till återkrav

1. Om en transportör har betalat ersättning enligt dessa enhetliga rättsregler, ska den gentemot de transportörer som har deltagit i transporten ha rätt till återkrav enligt följande bestämmelser:

a)Den transportör som orsakat skadan ska vara ensam ansvarig för den.

b)Om skadan har orsakats av flera transportörer, ska var och en av dem svaraför den del av skadan som den har orsakat. Om en sådan uppdelning inte är möjlig, ska ersättningsskyldigheten fördelas mellan dem enligt c.

c)Om det inte kan visas vilken av transportörerna som har orsakat skadan, ska ersättningsskyldigheten fördelas mellan alla transportörer som har deltagit i transporten, med undantag av dem som visar att skadan inte har orsakats av dem. Fördelningen ska ske i förhållande till deras respektive andelar av transportavgiften.

2. Om någon av transportörerna är på obestånd, ska den obetalda delen av den transportörens andel fördelas mellan de övriga transportörer som har deltagit i transporten i förhållande till deras respektive andelar av transportavgiften.

Artikel 63

Förfarandet i mål om återkrav

1. En transportör mot vilken återkrav riktas enligt artikel 62 får inte bestrida det befogade i en betalning som den åter- kravsökande transportören har gjort, om ersättningsbeloppet har fastställts av domstol och den transportör mot vilken åter- kravet riktas har blivit vederbörligen underrättad om stämningsansökan och beretts tillfälle att inträda som intervenient i målet. Domstolen i huvudmålet ska fastställa de frister inom vilka underrättelsen och ansökan om intervention ska göras.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/39

 

 

 

 

2.Den transportör som utövar sin rätt till återkrav ska i en och samma rättegång framföra sina anspråk mot samtliga transportörer med vilka den inte gjort upp i godo. I annat fall ska transportören förlora rätten till återkrav mot de trans- portörer som inte har stämts in.

3.Domstolen ska meddela en enda dom i fråga om alla återkrav som den handlägger.

4.Den transportör som önskar göra sin rätt till återkrav gällande får föra talan vid domstolarna i den stat på vars terri- torium någon av de transportörer som deltagit i transporten har sitt huvudkontor eller den filial eller agentur som ingått transportavtalet.

5.Om käromålet avser flera transportörer, får den transportör som utövar rätten till återkrav välja mellan de domstolar som är behöriga enligt punkt 4.

6.Talanomåterkravfårintetasuppienrättegångdärnågonyrkarskadeståndpågrundavsinrättenligttransportavtalet.

Artikel 64

Överenskommelser i fråga om återkrav

Transportörerna ska vara fria att sinsemellan komma överens om bestämmelser som avviker från artiklarna 61 och 62.

L 315/40

SV

Europeiska unionens officiella tidning

3.12.2007

 

 

 

 

BILAGA II

MINIMIINFORMATION SOM SKA LÄMNAS AV JÄRNVÄGSFÖRETAG OCH/ELLER BILJETTUTFÄRDARE

Del I: Information före resan

Allmänna avtalsvillkor.

Tidtabeller och villkor för den snabbaste resan.

Tidtabeller och villkor för det lägsta biljettpriset.

Möjligheterna att utnyttja förbindelserna, villkor för detta och tillgången till hjälpmedel ombord på tågen för personer med funktionshinder eller nedsatt rörlighet.

Möjligheten att medföra cyklar samt villkor för detta.

Tillgång på platser för rökare och icke-rökare, i första och andra klass samt i ligg- och sovvagnar.

Eventuella faktorer som kan leda till avbrott eller förseningar i trafiken.

Tillgång till tjänster ombord på tågen.

Förfaranden för att återfå förlorat resgods.

Förfaranden för inlämnande av klagomål.

Del II: Information under resan

Tjänster ombord på tågen.

Nästa station.

Förseningar.

Viktigare anslutande tåg.

Säkerhets- och trygghetsfrågor.

3.12.2007

SV

Europeiska unionens officiella tidning

L 315/41

 

 

 

 

BILAGA III

MINIMINORMER FÖR TJÄNSTEKVALITET

Information och biljetter.

Förbindelsernas punktlighet och allmänna principer för hantering av störningar i trafiken.

Inställda förbindelser.

Renhållning av vagnar och stationsområden (luftkvaliteten i vagnarna, toaletternas hygieniska standard etc.).

Enkät om kundtillfredsställelse.

Hantering av klagomål, återbetalning och ersättning för bristande kvalitet.

Assistans till personer med funktionshinder eller nedsatt rörlighet.

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/1

 

 

 

 

I

(Lagstiftningsakter)

FÖRORDNINGAR

EUROPAPARLAMENTETS OCH RÅDETS FÖRORDNING (EU) nr 1177/2010 av den 24 november 2010

om passagerares rättigheter vid resor till sjöss och på inre vattenvägar och om ändring av förordning (EG) nr 2006/2004

(Text av betydelse för EES)

EUROPAPARLAMENTET OCH EUROPEISKA UNIONENS RÅD HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om Europeiska unionens funktions­ sätt, särskilt artiklarna 91.1 och 100.2,

med beaktande av Europeiska kommissionens förslag,

med beaktande av Europeiska ekonomiska och sociala kommit­ téns yttrande (1),

efter att ha hört Regionkommittén,

i enlighet med det ordinarie lagstiftningsförfarandet (2), och

av följande skäl:

(1)Unionens åtgärder på sjötransportområdet bör bland annat ha som syfte att säkerställa att passagerarna har en hög skyddsnivå som är jämförbar med den som gäller för andra transportsätt. Dessutom bör de allmänna konsument­ skyddskraven beaktas fullt ut.

(1) EUT C 317, 23.12.2009, s. 89.

(2) Europaparlamentets ståndpunkt av den 23 april 2009 (EUT C 184 E, 8.7.2010, s. 293), rådets ståndpunkt vid första behandlingen av den 11 mars 2010 (EUT C 122 E, 11.5.2010, s. 19), Europaparlamentets ståndpunkt av den 6 juli 2010 (ännu ej offentliggjord i EUT) och rådets beslut av den 11 oktober 2010

(2)Eftersom passageraren till sjöss och på inre vattenvägar är den svagare parten i ett transportavtal bör alla sådana pas­ sagerare garanteras en lägsta skyddsnivå. Ingenting bör hindra transportörerna från att erbjuda avtalsvillkor som är gynnsammare för passagerarna än de villkor som fastställs i denna förordning. Syftet med denna förordning är emel­ lertid inte att ingripa i affärsförhållanden mellan företag avseende godstransporter. Särskilt avtal mellan en åkare och en transportör bör inte anses vara ett transportavtal enligt definitionen i denna förordning och bör därför inte ge åkaren eller dennes personal rätt till ersättning enligt denna förordning vid förseningar.

(3)Skyddet av passagerare bör inte enbart omfatta passagerar­ transporter mellan hamnar belägna inom medlemsstater­ nas territorium, utan också passagerartransporter mellan sådana hamnar och hamnar utanför medlemsstaternas ter­ ritorium, med beaktande av risken för snedvridning av konkurrensen på marknaden för passagerartrafik. Därför bör begreppet ”unionstransportör” i denna förordning tol­ kas så brett som möjligt utan att påverka andra unions­ rättsakter, t.ex. rådets förordning (EEG) nr 4056/86 av den 22 december 1986 om detaljerade regler för tillämpningen av artiklarna 85 och 86 i fördraget på sjöfarten (3) och rådets förordning (EEG) nr 3577/92 av den 7 december 1992 om tillämpning av principen om frihet att tillhanda­ hålla tjänster på sjötransportområdet inom medlemssta­ terna (cabotage) (4).

(3) EGT L 378, 31.12.1986, s. 4. (4) EGT L 364, 12.12.1992, s. 7.

L 334/2

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

(4)Den inre marknaden för passagerartransporter till sjöss och på inre vattenvägar bör gagna den stora allmänheten. Det betyder att personer med funktionshinder eller med ned­ satt rörlighet, oavsett om detta orsakas av funktionsned­ sättning, ålder eller andra faktorer, bör ha möjlighet att utnyttja passagerartransporter och kryssningar som är jäm­ förbara med andra medborgares möjligheter. Personer med funktionshinder eller nedsatt rörlighet har samma rättig­ heter som alla andra personer vad gäller fri rörlighet, val­ frihet och icke-diskriminering.

(5)Medlemsstater bör främja användningen av kollektivtrafik och samordnade biljetter för att till fullo utnyttja möjlig­ heterna till samtrafik mellan olika transportslag och aktörer.

(6)Mot bakgrund av artikel 9 i Förenta nationernas konven­ tion om rättigheter för personer med funktionsnedsättning och för att ge personer med funktionshinder eller nedsatt rörlighet de möjligheter till resor till sjöss och på inre vat­ tenvägar som är jämförbara med övriga medborgares möj­ ligheter, bör det fastställas regler för icke-diskriminering och assistans under resan. Dessa personer bör därför accep­ teras för transport och inte vägras transport, utom när detta är motiverat av säkerhetsskäl och när det fastslås av behöriga myndigheter. De bör ha rätt till assistans i ham­ nar och ombord på passagerarfartyg. Med hänsyn till den sociala delaktigheten bör de berörda personerna få sådan assistans kostnadsfritt. Transportörerna bör fastställa till­ gänglighetsvillkor, helst med användning av det europeiska standardiseringssystemet.

(7)I samband med beslut om utformning av nya hamnar och terminaler och vid större renoveringar bör de organ som ansvarar för dessa anläggningar ta hänsyn till behoven hos personer med funktionshinder eller nedsatt rörlighet, i syn­ nerhet med avseende på tillgänglighet, med särskild hän­ syn till de krav som uppstår till följd av principen om ”design för alla”. Transportörerna bör ta hänsyn till sådana behov när de fattar beslut om utformning av nya passage­ rarfartyg eller renovering av passagerarfartyg i enlighet med Europaparlamentets och rådets direktiv 2006/87/EG av den 12 december 2006 om tekniska föreskrifter för far­ tyg i inlandssjöfart (1) och Europaparlamentets och rådets direktiv 2009/45/EG av den 6 maj 2009 om säkerhetsbe­ stämmelser och säkerhetsnormer för passagerarfartyg (2).

(8)Assistans i hamnar på en medlemsstats territorium bör bland annat göra det möjligt för personer med funktions­ hinder eller nedsatt rörlighet att ta sig från en angiven

(1) EUT L 389, 30.12.2006, s. 1. (2) EUT L 163, 25.6.2009, s. 1.

ankomstpunkt i en hamn till ett passagerarfartyg samt från ett passagerarfartyg till en angiven avresepunkt i en hamn, inbegripet ombordstigning och landstigning.

(9)När transportörer organiserar assistansen till personer med funktionshinder eller nedsatt rörlighet samt utbildningen av sin personal bör de samarbeta med organisationer som företräder personer med funktionshinder eller nedsatt rör­ lighet. I detta arbete bör de också beakta relevanta bestäm­ melser i den internationella konventionen och koden om normer för sjöfolks utbildning, certifiering och vakthåll­ ning samt rekommendationen från Internationella sjöfarts­ organisationen (IMO) om handikappanpassning av passagerarfartyg för att tillgodose behoven hos äldre per­ soner och personer med funktionshinder.

(10)Bestämmelserna om ombordstigning för personer med funktionshinder eller nedsatt rörlighet bör inte påverka de allmänna regler om passagerares ombordstigning som fast­ ställts via gällande internationella eller nationella regler eller unionsregler.

(11)Unionsrättsakter om passagerares rättigheter bör ta hän­ syn till passagerarnas behov, i synnerhet de behov som personer med funktionshinder eller nedsatt rörlighet har, av att använda olika transportslag och på ett smidigt sätt kunna byta mellan dessa, med förbehåll för de tillämpliga säkerhetsbestämmelserna för driften av fartyg.

(12)Om en persontransport eller kryssning ställs in eller förse­ ningar uppstår bör passagerarna underrättas på ett adek­ vat sätt. Informationen bör underlätta för passagerarna att vidta nödvändiga åtgärder och om nödvändigt inhämta information om alternativa förbindelser.

(13)De olägenheter som passagerarna upplever till följd av inställda resor eller kraftiga förseningar bör minimeras. Passagerarna bör därför tas om hand på ett adekvat sätt och ges möjlighet att annullera resan och få ersättning för biljetten eller göra en ombokning på tillfredsställande vill­ kor. Lämplig inkvartering för passagerarna behöver inte nödvändigtvis vara hotellrum utan kan även vara annan lämplig inkvartering som finns tillgänglig, beroende på framför allt omständigheterna i varje enskilt fall, passage­ rarnas fordon och fartygets egenskaper. I detta samman­ hang och i vederbörligt motiverade fall med extraordinära och brådskande omständigheter bör transportörer ha möj­ lighet att till fullo utnyttja tillgängliga relevanta resurser i samarbete med civila myndigheter.

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/3

 

 

 

 

(14)Transportörerna bör se till att ersättning betalas ut till pas­ sagerarna om passagerartransporter ställs in eller blir för­ senade, baserat på en procentandel av biljettpriset, utom när den inställda transporten eller förseningen beror på väderförhållanden som äventyrar den säkra driften av far­ tyget eller på extraordinära omständigheter som inte kunde ha undvikits även om alla rimliga åtgärder hade vidtagits.

(15)I enlighet med allmänt accepterade principer bör transpor­ törerna ha bevisbördan för att visa att en inställd resa eller försening beror på sådana väderförhållanden eller extraor­ dinära omständigheter.

(16)Väderförhållanden som äventyrar den säkra driften av far­ tyget bör omfatta men inte begränsas till hårda vindar, kraftig sjögång, starka strömmar, svåra isförhållanden, extremt höga eller låga vattennivåer, orkaner, tornador och översvämningar.

(17)Extraordinära omständigheter bör omfatta men inte begränsas till naturkatastrofer som eldsvådor och jordbäv­ ningar, terrorattacker, krig och väpnade militära eller civila konflikter, uppror, militära eller illegala konfiskeringar, arbetskonflikter, landsättning av sjuka, skadade eller avlidna personer, sök- och räddningsinsatser till sjöss eller på inre vattenvägar, åtgärder som är nödvändiga för att skydda miljön, trafikledningsorgans eller hamnmyndighe­ ters beslut, eller behöriga myndigheters beslut avseende all­ män ordning och säkerhet, samt för att uppfylla akuta transportbehov.

(18)Transportörerna bör i samarbete med intressegrupper, näringslivsorganisationer, konsumentorganisationer, pas­ sagerare, personer med funktionshinder eller personer med nedsatt rörlighet vidta åtgärder på nationell eller europeisk nivå för att förbättra omhändertagandet av och assistan­ sen till passagerare vid störningar av resan, särskilt när det gäller kraftiga förseningar eller inställda resor. Nationella tillsynsorgan bör informeras om dessa arrangemang.

(19)Europeiska unionens domstol har redan fastställt att pro­ blem som leder till inställda resor eller förseningar kan anses bero på extraordinära omständigheter endast om de orsakas av händelser som inte ingår i det normala utföran­ det av transportörens verksamhet och som står utanför dennes kontroll. Det bör noteras att väderförhållanden som äventyrar den säkra driften av fartyget förvisso står utanför transportörens kontroll.

(20)Denna förordning bör inte påverka andra rättigheter för passagerare som fastställs i rådets direktiv 90/314/EEG av den 13 juni 1990 om paketresor, semesterpaket och andra paketarrangemang (1). Denna förordning bör inte vara til­ lämplig om ett paketarrangemang ställs in av andra skäl än att passagerartransporten eller kryssningen ställs in.

(21)Passagerarna bör få fullständig information om sina rättig­ heter enligt denna förordning i former som är tillgängliga för alla, så att de kan utöva dessa rättigheter på ett effektivt sätt. Rättigheterna för passagerare bör inbegripa erhållan­ det av information om passagerartransporten eller kryss­ ningen före och under resan. All viktig information till passagerarna bör också lämnas i en form som är tillgäng­ lig för personer med funktionshinder eller nedsatt rörlig­ het, där passagerarna får tillgång till samma information med hjälp av t.ex. text, punktskrift, audioformat, videofor­ mat och/eller elektroniska format.

(22)Passagerarna bör kunna utöva sina rättigheter med hjälp av lämpliga och tillgängliga klagomålsförfaranden som trans­ portörerna och terminaloperatörerna har inrättat inom sina respektive behörighetsområden eller, i förekommande fall, genom att lämna klagomål till det eller de organ som medlemsstaten i fråga har utsett för detta ändamål. Trans­ portörerna och terminaloperatörerna bör svara på passa­ gerarnas klagomål inom en fastställd tidsperiod, med beaktande av att om de underlåter att reagera på ett klago­ mål skulle detta kunna läggas dem till last.

(23)Med beaktande av de förfaranden som en medlemsstat inrättat för inlämnande av klagomål, bör ett klagomål som gäller assistans i en hamn eller ombord på ett fartyg helst riktas till det eller de organ som har utsatts för att se till att denna förordning efterlevs i den medlemsstat där ombord­ stigningshamnen är belägen och, för passagerartranspor­ ter från ett tredjeland, där landstigningshamnen är belägen.

(24)Medlemsstaterna bör se till att denna förordning efterlevs samt utse ett eller flera behöriga tillsynsorgan för övervak­ ning och genomförande. Detta påverkar inte passagerarnas rätt att få sin sak prövad i domstol i enlighet med nationell lagstiftning.

(25)Det eller de organ som har ansvar för genomförandet av denna förordning bör vara oberoende av kommersiella intressen. Varje medlemsstat bör utse minst ett organ som,

(1) EGT L 158, 23.6.1990, s. 59.

L 334/4

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

i tillämpliga fall, ges behörighet och kapacitet att under­ söka enskilda klagomål och underlätta tvistlösning. Passa­ gerare bör ha rätt att få ett underbyggt svar från det behöriga organet inom rimlig tid. Med tanke på hur viktig tillförlitlig statistik är för genomförandet av denna förord­ ning, i synnerhet när det gäller att säkerställa en samstäm­ mig tillämpning inom hela unionen, bör rapporterna från organen om möjligt innehålla statistik över klagomål och vilka resultat de gav.

(26)Medlemsstaterna bör fastställa sanktioner som ska gälla vid överträdelser av denna förordning och se till att de tilläm­ pas. Dessa sanktioner bör vara effektiva, proportionella och avskräckande.

(27)Eftersom målen för denna förordning, nämligen att säker­ ställa en hög nivå för skydd av och assistans till passage­ rare i alla medlemsstater och se till att de ekonomiska aktörerna verkar under harmoniserade villkor på den inre marknaden, inte i tillräcklig utsträckning kan uppnås av medlemsstaterna och de därför, på grund av åtgärdens omfattning och verkningar, bättre kan uppnås på unions­ nivå, kan unionen vidta åtgärder i enlighet med subsidia­ ritetsprincipen i artikel 5 i fördraget om Europeiska unionen. I enlighet med proportionalitetsprincipen i samma artikel går denna förordning inte utöver vad som är nödvändigt för att nå dessa mål.

(28)Kontrollen av efterlevnaden av denna förordning bör grunda sig på Europaparlamentets och rådets förordning (EG) nr 2006/2004 av den 27 oktober 2004 om samar­ bete mellan de nationella tillsynsmyndigheter som ansva­ rar för konsumentskyddslagstiftningen (”förordningen om konsumentskyddssamarbete”) (1). Den förordningen bör därför ändras i enlighet med detta.

(29)Europaparlamentets och rådets direktiv 95/46/EG av den 24 oktober 1995 om skydd för enskilda personer med avseende på behandling av personuppgifter och om det fria flödet av sådana uppgifter (2) bör respekteras och föl­ jas strikt för att garantera rätten till privatliv för fysiska och juridiska personer och för att säkerställa att den begärda informationen och rapporterna endast används för att full­ följa de skyldigheter som fastställs i denna förordning och inte används på ett sätt som skadar sådana personer.

(30)Denna förordning står i överensstämmelse med de grund­ läggande rättigheter och de principer som erkänns särskilt i Europeiska unionens stadga om de grundläggande rättig­ heterna, som det hänvisas till i artikel 6 i fördraget om Europeiska unionen.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

(1) EUT L 364, 9.12.2004, s. 1. (2) EGT L 281, 23.11.1995, s. 31.

KAPITEL I

ALLMÄNNA BESTÄMMELSER

Artikel 1

Syfte

I denna förordning fastställs regler om transport till sjöss och på inre vattenvägar vad gäller följande:

a)Icke-diskriminering mellan passagerare när det gäller de transportvillkor som transportörerna erbjuder.

b)Icke-diskriminering av och assistans till personer med funk­ tionshinder eller nedsatt rörlighet.

c)Passagerares rättigheter vid inställda resor eller förseningar.

d)Minsta information som ska lämnas till passagerarna.

e)Hantering av klagomål.

f)Allmänna regler om kontroll av efterlevnaden.

Artikel 2

Tillämpningsområde

1.Denna förordning ska tillämpas på passagerare som reser

a)med passagerartransport där ombordstigningshamnen är belägen inom en medlemsstats territorium,

b)med passagerartransport där ombordstigningshamnen är belägen utanför en medlemsstats territorium och landstig­ ningshamnen är belägen inom en medlemsstats territorium, förutsatt att transporten genomförs av en unionstransportör enligt definitionen i artikel 3 e,

c)på en kryssning där ombordstigningshamnen är belägen inom en medlemsstats territorium. Artiklarna 16.2, 18, 19, 20.1 och 20.4 ska dock inte tillämpas på dessa passagerare.

2. Denna förordning ska inte tillämpas på passagerare som reser

a)med fartyg som är certifierade för högst 12 passagerare,

b)med fartyg som har en besättning med ansvar för fartygets drift som inte uppgår till fler än tre personer eller när sträckan för den totala passagerartransporten understiger 500 meter enkel resa,

c)på andra utflykts- och sightseeingturer än kryssningar, eller

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/5

 

 

 

 

d)med fartyg som inte drivs mekaniskt eller med ursprungliga historiska passagerarfartyg konstruerade före 1965 eller kopior av sådana, till övervägande del byggda i de ursprung­ liga materialen och certifierade för högst 36 passagerare.

3. Medlemsstaterna får, under två år från och med den 18 december 2012, undanta från tillämpningen av denna förord­ ning sjögående fartyg på mindre än 300 bruttoton som används för inhemska transporter, förutsatt att passagerarnas rättigheter enligt denna förordning är tillräckligt säkerställda i nationell lagstiftning.

4.Medlemsstaterna får undanta från tillämpningen av denna förordning passagerartransporter som omfattas av förpliktelser om allmännyttiga tjänster, avtal om allmännyttiga tjänster eller integrerade tjänster, förutsatt att passagerarnas rättigheter enligt denna förordning är likvärdigt garanterade i nationell lagstiftning.

5.Utan att detta påverkar direktiv 2006/87/EG och direktiv 2009/45/EG, ska ingenting i denna förordning tolkas som tek­ niska krav som ålägger transportörer, terminaloperatörer eller andra personer eller företag skyldigheter att ändra eller ersätta far­ tyg, infrastruktur, hamnar eller hamnterminaler.

Artikel 3

Definitioner

I denna förordning gäller följande definitioner:

a)person med funktionshinder eller person med nedsatt rörlighet: en person vars rörlighet är nedsatt i samband med utnyttjande av transporter på grund av någon form av fysiskt funktions­ hinder (sensoriskt eller motoriskt, bestående eller tillfälligt), psykiskt funktionshinder eller psykisk funktionsnedsättning eller på grund av annat funktionshinder eller ålder, och vars situation kräver lämplig uppmärksamhet och anpassning till denna persons särskilda behov beträffande de tjänster som alla passagerare har tillgång till,

b)medlemsstats territorium: ett territorium inom vilket fördraget är tillämpligt enligt artikel 355 i fördraget på de villkor som fastställs där,

c)villkor för tillgänglighet: relevanta normer och riktlinjer för samt information om tillgängligheten hos hamnterminaler och fartyg, inbegripet deras installationer för personer med funktionshinder eller nedsatt rörlighet,

d)transportör: en fysisk eller juridisk person som inte är en rese­ arrangör, resebyrå eller biljettutfärdare, och som erbjuder transporter i form av passagerartransporter eller kryssningar till allmänheten,

e)unionstransportör: en transportör som är etablerad inom en medlemsstats territorium eller erbjuder transporter i form av passagerartransporter till eller från en medlemsstats territorium,

f)passagerartransport: kommersiell passagerartrafik till sjöss eller på inre vattenvägar enligt en offentliggjord tidtabell,

g)integrerade tjänster: transporttjänster som inom ett fastställt geografiskt område är sammanbundna med varandra, med en enda informationstjänst, ett enda biljettsystem och en enda tidtabell,

h)utförande transportör: en annan person än transportören vil­ ken faktiskt utför hela eller en del av transporten,

i)inre vattenväg: naturlig eller konstgjord vattenförekomst, eller system med sammanbundna vattenförekomster, som används för transport, t.ex. sjöar, floder eller kanaler, eller kombinationer av dessa,

j)hamn: en plats eller ett geografiskt område där det har gjorts sådana förbättringsarbeten och finns sådana anläggningar som krävs för att möjliggöra mottagande av fartyg, från vilka passagerare regelbundet kan gå ombord eller i land,

k)hamnterminal: en terminal bemannad av en transportör eller terminaloperatör i en hamn med anläggningar, t.ex. incheck­ ning, biljettluckor eller vänthallar, och personal för ombord­ stigning och landstigning av passagerare som reser med en passagerartransport eller på en kryssning,

l)fartyg: farkost som används för trafik till sjöss eller på inre vattenvägar,

m)transportavtal: ett avtal om transport mellan en transportör och en passagerare om tillhandahållande av en eller flera pas­ sagerartransporter eller kryssningar,

n)biljett: en giltig färdhandling eller annat bevis på transportavtal,

o)biljettutfärdare: återförsäljare som ingår transportavtal för en transportörs räkning,

p)resebyrå: återförsäljare som agerar för en passagerares eller en researrangörs räkning vid ingående av transportavtal,

q)researrangör: annan arrangör eller återförsäljare av resepaket än en transportör, i den mening som avses i artikel 2.2 och 2.3 i direktiv 90/314/EEG,

r)bokning: bokning av en specifik avgång för en passagerartran­ sport eller en kryssning,

L 334/6

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

s)terminaloperatör: ett privat eller offentligt organ inom en med­ lemsstats territorium med ansvar för administration och skötsel av en hamnterminal,

t)kryssning: en transport till sjöss eller på inre vattenvägar som bedrivs enbart i nöjes- eller rekreationssyfte, kompletterad med inkvartering och andra tjänster och som varar mer än två övernattningar ombord,

u)sjöfartsolycka: förlisning, kantring, sammanstötning eller strandning av fartyget, explosion eller brand i fartyget eller fel i fartyget.

Artikel 4

Biljetter och icke-diskriminerande avtalsvillkor

1.Transportören ska utfärda en biljett till passageraren, såvida inte andra handlingar ger rätt till transport enligt nationell lagstift­ ning. Biljetter får utfärdas i elektronisk form.

2.Utan att det påverkar subventionerade taxor, ska de avtals­ villkor och taxor som tillämpas av transportörer eller biljettutfär­ dare erbjudas till allmänheten utan någon som helst direkt eller indirekt diskriminering på grundval av den slutliga kundens natio­ nalitet eller transportörernas eller biljettutfärdarens etableringsort inom unionen.

Artikel 5

Andra utförande parter

1.Transportörer, resebyråer, researrangörer eller terminalope­ ratörer som anförtrott en utförande transportör, biljettutfärdare eller annan person utförandet av åligganden enligt denna förord­ ning ska ändå vara ansvariga för den utförande partens handlande eller underlåtenhet, när denne handlar inom ramen för sitt uppdrag.

2.Förutom vad som sägs i punkt 1 ska dessutom den part som transportören, resebyrån, researrangören eller terminaloperatören har anförtrott att utföra ett åliggande även omfattas av bestäm­ melserna i denna förordning, inbegripet bestämmelser om ansvar­ skyldighet och invändningar, med avseende på det åliggande som anförtrotts.

Artikel 6

Ansvarsbegränsning

Rättigheterna och skyldigheterna enligt denna förordning får inte åsidosättas eller begränsas, i synnerhet inte genom undantag eller restriktioner i transportavtalet.

KAPITEL II

RÄTTIGHETER FÖR PERSONER MED FUNKTIONSHINDER

ELLER NEDSATT RÖRLIGHET

Artikel 7

Rätt till transport

1.Transportörer, resebyråer eller researrangörer får inte med hänvisning till funktionshinder eller nedsatt rörlighet i sig vägra att godkänna en bokning, att utfärda eller på annat sätt tillhanda­ hålla en biljett eller att tillåta ombordstigning.

2.Bokningar och biljetter ska utan extra kostnad erbjudas till personer med funktionshinder eller nedsatt rörlighet enligt samma villkor som gäller för alla andra passagerare.

Artikel 8

Undantag och särskilda villkor

1. Genom undantag från artikel 7.1 får transportörer, reseby­ råer och researrangörer vägra att godkänna en bokning, utfärda eller på annat sätt tillhandahålla en biljett eller tillåta ombordstig­ ning för en person med funktionshinder eller nedsatt rörlighet

a)för att uppfylla tillämpliga säkerhetskrav som fastställts i internationell lagstiftning, unionslagstiftning eller nationell lagstiftning eller för att uppfylla säkerhetskrav som fastställts av de behöriga myndigheterna,

b)om utformningen av passagerarfartyget eller av hamnens infrastruktur och utrustning, inbegripet hamnterminaler, gör det omöjligt att låta vederbörande stiga ombord, gå i land eller befordras på ett säkert eller operativt möjligt sätt.

2.Om vägran att godkänna en bokning, eller utfärda eller på annat sätt tillhandahålla en biljett, grundas på de skäl som anges i punkt 1, ska transportören, resebyråerna och researrangörerna göra alla rimliga ansträngningar för att erbjuda den berörda per­ sonen ett godtagbart transportalternativ med en passagerartran­ sport eller en kryssning som transportören utför.

3.Om en person med funktionshinder eller nedsatt rörlighet som har en bokning eller en biljett och som uppfyllt kraven som avses i artikel 11.2 ändå vägras ombordstigning på grundval av denna förordning, ska denna person och eventuella ledsagare som avses i punkt 4 i den här artikeln ges möjlighet att välja mellan rätt till återbetalning och ombokning i enlighet med i bilaga I. Rät­ tigheten till en returresa eller ombokning gäller under förutsätt­ ning att alla säkerhetskrav uppfylls.

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/7

 

 

 

 

4.Om detta är absolut nödvändigt får transportörer, reseby­ råer och researrangörer, enligt samma villkor som anges i punkt 1, kräva att en person med funktionshinder eller nedsatt rörlighet ledsagas av en annan person som kan ge den assistans som per­ sonen med funktionshinder eller nedsatt rörlighet behöver. När det gäller passagerartransporter ska en sådan ledsagares resa vara kostnadsfri.

5.När transportörer, resebyråer eller researrangörer tillämpar bestämmelserna i punkterna 1 eller 4 ska de omedelbart under­ rätta personen med funktionshinder eller nedsatt rörlighet om de specifika skälen till detta. På begäran ska dessa skäl skriftligen meddelas personen med funktionshinder eller nedsatt rörlighet inom fem arbetsdagar efter begäran. Vid vägran enligt punkt 1 a ska en hänvisning till de tillämpliga säkerhetskraven göras.

Artikel 9

Tillgänglighet och information

1.I samarbete med organisationer som företräder personer med funktionshinder eller nedsatt rörlighet ska transportörer och terminaloperatörer, i förekommande fall genom sina organisatio­ ner, ha eller fastställa icke-diskriminerande villkor för tillgänglig­ het för befordran av personer med funktionshinder och personer med nedsatt rörlighet och deras ledsagare. Villkoren för tillgäng­ lighet ska på begäran meddelas de nationella tillsynsorganen.

2.Transportörerna och terminaloperatörerna ska offentliggöra villkoren för tillgänglighet som anges i punkt 1 fysiskt eller på Internet, på begäran i en tillgänglig form, på samma språk som det på vilket information i allmänhet görs tillgänglig för alla pas­ sagerare. Särskild vikt ska fästas vid behoven hos personer med funktionshinder eller nedsatt rörlighet.

3.Researrangörer ska tillhandahålla villkoren för tillgänglig­ het som anges i punkt 1 och som tillämpas på resor som ingår i paketresor, semesterpaket och andra paketarrangemang som de organiserar, säljer eller erbjuder till försäljning.

4.Transportörer, resebyråer och researrangörer ska se till, inbegripet vid bokning och information på Internet, att all rele­ vant information om transportvillkoren, information om resan och villkoren för tillgänglighet finns att tillgå i en form som läm­ par sig och är tillgänglig för personer med funktionshinder eller nedsatt rörlighet. Personer som har behov av assistans ska erhålla en bekräftelse på denna assistans på något sätt, inbegripet i elek­ troniskt format eller textmeddelande (sms).

Artikel 10

Rätt till assistans i hamnar och ombord på fartyg

Om inte annat följer av villkoren för tillgänglighet som anges i artikel 9.1 ska transportörer och terminaloperatörer inom sina

respektive behörighetsområden ge personer med funktionshinder och personer med nedsatt rörlighet kostnadsfri assistans i enlig­ het med bilagorna II och III i hamnar, inbegripet vid ombordstig­ ning och landstigning, och ombord på fartyg. Assistansen ska om möjligt anpassas till de individuella behoven hos personen med funktionshinder eller nedsatt rörlighet.

Artikel 11

Villkor för assistans

1. Transportörer och terminaloperatörer ska inom sina respek­ tive behörighetsområden ge assistans till personer med funktions­ hinder eller nedsatt rörlighet i enlighet med artikel 10 förutsatt att:

a)Transportören eller terminaloperatören underrättas på något sätt, inbegripet elektroniskt eller via sms, om personens behov av denna assistans senast 48 timmar innan assistan­ sen behövs, om inte passageraren och transportören eller ter­ minaloperatören kommer överens om en kortare tid.

b)Personen med funktionshinder eller nedsatt rörlighet instäl­ ler sig personligen i hamnen eller på den anvisade platsen enligt artikel 12.3

i)vid den tidpunkt som transportören skriftligen har fast­ ställt, dock inte mer än 60 minuter före angiven ombord­ stigningstid, eller

ii)om ingen tidpunkt har fastställts, senast 60 minuter före den angivna avgångstiden, om inte passageraren och transportören eller terminaloperatören kommer överens om en kortare tid.

2.Förutom vad som sägs i punkt 1 ska personer med funk­ tionshinder eller nedsatt rörlighet, vid tidpunkten för bokningen eller förköpet av biljett, underrätta transportören om sina sär­ skilda behov i fråga om inkvartering, sittplatser eller särskild ser­ vice eller sitt behov av att medföra medicinsk utrustning, förutsatt att behovet i fråga är känt vid den tidpunkten.

3.En underrättelse som görs enligt punkterna 1 a och 2 får all­ tid lämnas till den resebyrå eller researrangör hos vilken biljetten köptes. Om biljetten omfattar flera resor ska det vara tillräckligt med en enda underrättelse förutsatt att tillbörlig information läm­ nas om tidpunkterna för efterföljande resor. Passageraren ska erhålla en bekräftelse på att underrättelsen om behovet av assis­ tans har skett på tillbörligt sätt i enlighet med punkterna 1 a och 2.

4.Om ingen underrättelse görs enligt punkterna 1 a och 2 ska transportörerna och terminaloperatörerna ändå göra alla rimliga ansträngningar för att se till att assistans ges på ett sådant sätt att personen med funktionshinder eller nedsatt rörlighet kan gå ombord på och i land från fartyget samt resa med fartyget.

L 334/8

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

5. När en person med funktionshinder eller nedsatt rörlighet åtföljs av en erkänd ledarhund, ska denna få åtfölja personen vid transporten förutsatt att transportören, resebyrån eller resear­ rangören underrättas i enlighet med tillämpliga nationella regler om transport av erkända ledarhundar ombord på passagerarfar­ tyg, i den mån sådana regler finns.

Artikel 12

Mottagning av underrättelser och anvisning av mötesplatser

1.Transportörer, terminaloperatörer, resebyråer och resear­ rangörer ska vidta alla åtgärder som är nödvändiga för begäran om underrättelse och mottagning av underrättelser utförda i enlighet med artikel 11.1 a och 11.2. Denna skyldighet ska gälla vid alla deras försäljningspunkter, inbegripet försäljning per tele­ fon och på Internet.

2.När resebyråer eller researrangörer mottar en underrättelse enligt punkt 1 ska de under ordinarie arbetstid och utan dröjsmål vidarebefordra denna information till transportören eller terminaloperatören.

3.Transportörer och terminaloperatörer ska anvisa platser i eller utanför hamnterminaler, där personer med funktionshinder eller nedsatt rörlighet kan anmäla sin ankomst och begära assis­ tans. Dessa platser ska vara tydligt skyltade och i tillgänglig form erbjuda grundläggande information om hamnterminalen och den assistans som erbjuds.

Artikel 13

Kvalitetsnormer för assistans

1.Terminaloperatörer och transportörer som driver hamnter­ minaler eller utför passagerartransporter med totalt över 100 000 kommersiella passagerarrörelser under det föregående kalender­ året ska inom sina respektive behörighetsområden fastställa kva­ litetsnormer för den assistans som anges i bilagorna II och III och, i tillämpliga fall genom sina organisationer, fastställa resurskrav för att uppfylla dessa normer i samarbete med organisationer som företräder personer med funktionshinder eller nedsatt rörlighet.

2.När kvalitetsnormerna fastställs ska full hänsyn tas till inter­ nationellt erkända strategier och uppförandekoder som syftar till att underlätta resandet för personer med funktionshinder eller nedsatt rörlighet, särskilt rekommendationen från IMO om anpassning av passagerarfartyg till äldres och funktionshindrades behov.

3.Terminaloperatörer och transportörer ska offentliggöra de kvalitetsnormer som avses i punkt 1, fysiskt eller på Internet i till­ gänglig form och på samma språk som information i allmänhet görs tillgänglig för alla passagerare.

Artikel 14

Utbildning och instruktioner

Utan att det påverkar tillämpningen av den internationella kon­ ventionen och koden om normer för sjöfolks utbildning, certifie­ ring och vakthållning och de bestämmelser som antagits enligt den reviderade konventionen för sjöfarten på Rhen och konven­ tionen om regelverket för sjöfarten på Donau, ska transportörer och, i förekommande fall, terminaloperatörer införa förfaranden för utbildning om funktionshinder, inbegripet instruktioner, och se till att

a)deras personal, inbegripet alla personer som anställts av någon annan utförande part, som ger direkt assistans till per­ soner med funktionshinder eller nedsatt rörlighet, har fått utbildning eller instruktioner enligt bilaga IV delarna A och B,

b)deras personal som annars ansvarar för bokning och biljett­ försäljning eller ombordstigning och landstigning, inbegripet personal som anställts av någon annan utförande part, har fått utbildning eller instruktioner enligt bilaga IV del A, och

c)de personalkategorier som avses i leden a och b bibehåller sin kompetens genom t.ex. instruktioner eller fortbildningskur­ ser när så är lämpligt.

Artikel 15

Ersättning för rörelsehjälpmedel eller annan specifik utrustning

1.Transportörer och terminaloperatörer ska ansvara för skada som uppstått till följd av förlust av eller skador på rörelsehjälp­ medel eller annan specifik utrustning som används av en person med funktionshinder eller nedsatt rörelseförmåga, om den hän­ delse som orsakade förlusten berodde på fel eller försummelse från transportörens eller terminaloperatörens sida. Fel eller för­ summelse från transportörens sida ska antas föreligga om skadan har vållats genom en sjöfartsolycka.

2.Den ersättning som avses i punkt 1 ska motsvara återan­ skaffningsvärdet av berörd utrustning eller, i förekommande fall, reparationskostnaderna.

3.Punkterna 1 och 2 ska inte tillämpas om artikel 4 i Europa­ parlamentets och rådets förordning (EG) nr 392/2009 av den

23april 2009 om transportörens skadeståndsansvar i samband med olyckor vid passagerarbefordran till sjöss (1) är tillämplig.

4.Vidare ska alla ansträngningar göras för att snabbt få fram tillfälliga ersättningshjälpmedel som utgör lämpliga alternativ.

(1) EUT L 131, 28.5.2009, s. 24.

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/9

 

 

 

 

KAPITEL III

SKYLDIGHETER FÖR TRANSPORTÖRER OCH TERMINALOPERATÖRER VID STÖRNINGAR AV RESAN

Artikel 16

Information vid inställda eller försenade avgångar

1.Vid inställda eller försenade avgångar för passagerar­ transporter eller kryssningar ska transportören eller, i förekom­ mande fall, terminaloperatören underrätta de passagerare som ska resa från hamnterminalen eller, i den mån det är möjligt, de pas­ sagerare som ska resa från hamnen om läget så snart som möj­ ligt, dock senast 30 minuter efter angiven avgångstid, och om den beräknade avgångs- och ankomsttiden så snart som denna infor­ mation finns tillgänglig.

2.Om passagerare missar en anslutande transport på grund av en inställd eller försenad avgång, ska transportören och, i före­ kommande fall, terminaloperatören göra rimliga ansträngningar för att underrätta berörda passagerare om alternativa anslutningar.

3.Transportören eller, i förekommande fall, terminaloperatö­ ren ska se till att personer med funktionshinder eller nedsatt rör­ lighet får den information som krävs enligt punkterna 1 och 2 i tillgänglig form.

Artikel 17

Assistans vid inställda eller försenade avgångar

1.Om en transportör på skäliga grunder kan anta att en avgång med en passagerartransport eller en kryssning kommer att ställas in eller bli försenad med mer än 90 minuter i förhållande till den angivna avgångstiden, ska passagerare som reser från hamnterminaler kostnadsfritt erbjudas snacks, måltider eller för­ friskningar i skälig proportion till väntetiden, förutsatt att sådana finns tillgängliga eller på ett rimligt sätt kan tillhandahållas.

2.Vid inställda eller försenade avgångar som medför att pas­ sageraren måste övernatta en eller flera nätter eller bli kvar längre än planerat, ska transportören om det är fysiskt möjligt kostnads­ fritt erbjuda passagerare som reser från hamnterminaler lämplig inkvartering ombord eller i land och transport mellan hamnter­ minalen och inkvarteringen, utöver de snacks, måltider eller för­ friskningar som föreskrivs i punkt 1. Transportören får, för varje passagerare, begränsa den totala kostnaden för inkvartering i land till 80 EUR per natt, maximalt tre nätter, exklusive transport mel­ lan hamnterminalen och inkvarteringen.

3.När punkterna 1 och 2 tillämpas ska transportören särskilt uppmärksamma behoven hos personer med funktionshinder eller nedsatt rörlighet och deras eventuella ledsagare.

Artikel 18

Ombokning och återbetalning vid inställda eller försenade avgångar

1. Om en transportör på skäliga grunder kan anta att en pas­ sagerartransport kommer att ställas in eller att avgången från en hamnterminal försenas med mer än 90 minuter, ska passagerarna omedelbart få välja mellan

a)ombokning till en resa med jämförbara villkor enligt trans­ portavtalet till slutdestinationen så snart som möjligt och utan extra kostnad,

b)återbetalning motsvarande biljettpriset och, i tillämpliga fall, en kostnadsfri returresa till den första avresepunkten enligt transportavtalet så snart som möjligt.

2.Om en passagerartransport ställs in eller avgången från en hamn försenas med mer än 90 minuter, ska passagerarna ha rätt till sådan ombokning eller återbetalning motsvarande biljettpriset från transportören.

3.Den återbetalning som avses i punkterna 1 b och 2 ska göras inom sju dagar kontant, genom elektronisk banköverföring, bankgirering eller bankcheck och motsvara biljettens hela inköps­ pris, för den eller de delar av resan som inte har genomförts och för den eller de delar som redan har verkställts om resan inte längre tjänar något syfte i förhållande till passagerarens ursprung­ liga resplan. Efter överenskommelse med passageraren får återbe­ talningen även göras i form av värdebevis och/eller andra tjänster till ett belopp som motsvarar biljettens inköpspris, förutsatt att villkoren är flexibla, särskilt när det gäller giltighetsperioden och destinationen.

Artikel 19

Ersättning för biljettpriset vid försenad ankomst

1. Passagerare kan, utan att förlora rätten till transport, begära att få ersättning från transportören om deras ankomst till slutdes­ tinationen enligt transportavtalet försenas. Den lägsta ersätt­ ningen ska vara 25 % av biljettpriset för en försening på minst

a)en timme i fråga om en planerad resa på upp till fyra timmar,

b)två timmar i fråga om en planerad resa på över fyra timmar, men som inte överstiger åtta timmar,

c)tre timmar i fråga om en planerad resa på över åtta timmar, men som inte överstiger 24 timmar, eller

d)sex timmar i fråga om en planerad resa på över 24 timmar.

Om förseningen överskrider dubbla antalet timmar i leden a–d ska ersättning uppgå till 50 % av biljettpriset.

L 334/10

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

2.Passagerare som har ett abonnemang eller periodkort och som under dess giltighetstid upprepade gånger har drabbats av försenad ankomst får begära lämplig ersättning i enlighet med transportörens ersättningsbestämmelser. Dessa bestämmelser ska ange kriterierna för att fastställa försenad ankomst och beräkna ersättningen.

3.Ersättningen ska beräknas i proportion till det pris som pas­ sageraren faktiskt erlagt för den försenade passagerartransporten.

4.Om transporten avser en ut- och återresa ska ersättningen för försenad ankomst under antingen ut- eller återresan beräknas i proportion till halva det pris som erlagts för passagerartransporten.

5.Ersättningen ska betalas inom en månad från det att begä­ ran om ersättning lämnades in. Ersättningen får erläggas i form av värdebevis och/eller andra tjänster, förutsatt att villkoren är flexi­ bla, särskilt när det gäller giltighetsperioden och destinationen. På begäran av passageraren ska ersättningen betalas i pengar.

6.Ersättningen av biljettpriset får inte minskas genom avdrag för transaktionskostnader, till exempel avgifter eller telefon- eller portokostnader. Transportören får fastställa en lägsta gräns under vilken ingen ersättning ska utgå. Denna gräns får inte överskrida 6 EUR.

Artikel 21

Ytterligare fordringar

Ingenting i denna förordning ska hindra passagerare från att inför nationella domstolar begära skadestånd i enlighet med nationell lagstiftning när det gäller förluster till följd av inställda eller för­ senade transporttjänster, inbegripet enligt direktiv 90/314/EEG.

KAPITEL IV

ALLMÄNNA BESTÄMMELSER OM INFORMATION OCH

KLAGOMÅL

Artikel 22

Rätt till information om resan

Transportörer och terminaloperatörer ska inom sina respektive behörighetsområden ge passagerarna adekvat information i ett för alla tillgängligt format under hela resan och på samma språk som information i allmänhet görs tillgänglig för alla passagerare. Sär­ skild vikt ska fästas vid behoven hos personer med funktionshin­ der eller nedsatt rörlighet.

Artikel 20

Artikel 23

Undantag

Information om passagerarnas rättigheter

1.Artiklarna 17, 18 och 19 ska inte tillämpas på passagerare med öppna biljetter så länge som avgångstiden inte har specifice­ rats, med undantag för resenärer som har ett abonnemang eller periodkort.

2.Artiklarna 17 och 19 ska inte tillämpas om passageraren informeras om att avgången är inställd eller försenad före biljett­ köpet eller om förseningen eller den inställda turen beror på ett fel av passageraren.

3.Artikel 17.2 ska inte tillämpas om transportören kan bevisa att den inställda turen eller förseningen beror på väderförhållan­ den som äventyrar den säkra driften av fartyget.

4.Artikel 19 ska inte tillämpas om transportören kan bevisa att den inställda turen eller förseningen beror på väderförhållan­ den som äventyrar den säkra driften av fartyget, eller på extraordinära omständigheter som hindrar utförandet av passa­ gerartransporten, och som inte kunde ha undvikits även om alla rimliga åtgärder hade vidtagits.

1.Transportörer, terminaloperatörer och, i tillämpliga fall, hamnmyndigheter ska inom sina respektive behörighetsområden se till att information om passagerarnas rättigheter enligt denna förordning görs offentligt tillgänglig ombord på fartygen, i ham­ narna om det är möjligt och i hamnterminalerna. Informationen ska, så långt det är möjligt, tillhandahållas i tillgänglig form och på samma språk som information i allmänhet görs tillgänglig för alla passagerare. När den informationen tillhandahålls ska särskild vikt fästas vid behoven hos personer med funktionshinder eller nedsatt rörlighet.

2.För att uppfylla det informationskrav som avses i punkt 1 får transportörer, terminaloperatörer och, i tillämpliga fall, hamn­ myndigheter använda en sammanfattning av bestämmelserna i denna förordning som kommissionen utarbetat på Europeiska unionens samtliga officiella språk och gjort tillgänglig för dem.

3.Transportörer, terminaloperatörer och, i tillämpliga fall, hamnmyndigheter ska på lämpligt sätt ombord på fartygen, i hamnarna om det är möjligt och i hamnterminalerna informera passagerarna om kontaktuppgifterna till det tillsynsorgan som medlemsstaten i fråga har utsett enligt artikel 25.1.

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/11

 

 

 

 

Artikel 24

Klagomål

1.Transportörerna och terminaloperatörerna ska inrätta eller ha infört en tillgänglig mekanism för hantering av klagomål avse­ ende rättigheter och skyldigheter som omfattas av denna förordning.

2.Om en passagerare som omfattas av denna förordning vill lämna in ett klagomål till transportören eller terminaloperatören, ska denne göra detta inom två månader från den dag då tjänsten utfördes eller borde ha utförts. Inom en månad efter det att trans­ portören eller terminaloperatören mottagit ett klagomål, ska denne underrätta passageraren om huruvida hans klagomål har accepterats, avslagits eller fortfarande behandlas. Tiden för att lämna det slutliga svaret får inte överstiga två månader från mot­ tagandet av ett klagomål.

KAPITEL V

EFTERLEVNAD OCH NATIONELLA TILLSYNSORGAN

Artikel 25

Nationella tillsynsorgan

1. Varje medlemsstat ska utse ett eller flera nya eller befintliga organ med ansvar för att denna förordning efterlevs när det gäller passagerartransporter och kryssningar från hamnar inom det egna territoriet och passagerartransporter från ett tredjeland till sådana hamnar. Varje organ ska vidta de åtgärder som är nödvändiga för att se till att denna förordning efterlevs.

Varje organ ska vad gäller organisation, beslut om finansiering, rättslig struktur och beslutsfattande vara oberoende av kommer­ siella intressen.

2.Medlemsstaterna ska underrätta kommissionen om det eller de organ som de har utsett enligt denna artikel.

3.Alla passagerare får lämna klagomål i enlighet med natio­ nell lagstiftning till ett behörigt organ som har utsetts enligt punkt 1 eller till ett annat behörigt organ som en medlemsstat har utsett, när det gäller en påstådd överträdelse av denna förordning. Det behöriga organet ska inom rimlig tid ge passagerarna ett underbyggt svar på deras klagomål.

En medlemsstat får besluta

a)att passageraren som en första åtgärd ska lämna klagomålet enligt denna förordning till transportören eller terminalope­ ratören, och/eller

b)att det nationella tillsynsorganet eller annat behörigt organ som en medlemsstat utsett ska utgöra klagoinstans för de tvister som inte löses enligt artikel 24.

4. Medlemsstater som har valt att undanta vissa tjänster i enlig­ het med artikel 2.4 ska se till att det finns en jämförbar mekanism för kontroll av att passagerarnas rättigheter efterlevs.

Artikel 26

Rapport om efterlevnad

Senast den 1 juni 2015 och därefter vartannat år ska de tillsyns­ organ som har utsetts enligt artikel 25 lämna en rapport om sin verksamhet under de två föregående kalenderåren, med bland annat en beskrivning av de åtgärder som vidtagits för att genom­ föra bestämmelserna i denna förordning, närmare uppgifter om de sanktioner som har införts och statistiska uppgifter om de kla­ gomål och sanktioner som har tillämpats.

Artikel 27

Samarbete mellan tillsynsorgan

De nationella tillsynsorgan som avses i artikel 25.1 ska utbyta information om sitt arbete och sina beslutsprinciper och sin beslutspraxis, i den utsträckning detta är nödvändigt för en enhet­ lig tillämpning av denna förordning. Kommissionen ska stödja tillsynsorganen i det arbetet.

Artikel 28

Sanktioner

Medlemsstaterna ska fastställa regler för sanktioner vid överträ­ delse av bestämmelserna i denna förordning och vidta alla nöd­ vändiga åtgärder för att se till att de följs. De fastställda sanktionerna ska vara effektiva, proportionella och avskräckande. Medlemsstaterna ska anmäla dessa regler och åtgärder till kom­ missionen senast den 18 december 2012 och utan dröjsmål anmäla varje senare ändring som berör dem.

KAPITEL VI

SLUTBESTÄMMELSER

Artikel 29

Rapportering

Senast den 19 december 2015 ska kommissionen lämna en rap­ port till Europaparlamentet och rådet om hur denna förordning tillämpas och om dess verkan. Denna rapport ska vid behov åtföl­ jas av lagstiftningsförslag för mer detaljerat genomförande av bestämmelserna i denna förordning eller om ändringar av förordningen.

L 334/12

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

 

 

Artikel 30

Artikel 31

Ändring av förordning (EG) nr 2006/2004

Ikraftträdande

I bilagan till förordning (EG) nr 2006/2004 ska följande punkt läggas till:

”18. Europaparlamentets och rådets förordning (EU) nr 1177 /2010 av den 24 november 2010 om passagerares rättighe­ ter vid resor till sjöss och på inre vattenvägar (*).

(*) EUT L 334, 17.12.2010, s. 1.”

Denna förordning träder i kraft den tjugonde dagen efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Den ska tillämpas från och med den 18 december 2012.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Strasbourg den 24 november 2010.

 

På Europaparlamentets vägnar

På rådets vägnar

J. BUZEK

O. CHASTEL

Ordförande

Ordförande

 

 

 

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/13

 

 

 

 

BILAGA I

RÄTT TILL ÅTERBETALNING ELLER OMBOKNING FÖR PERSONER MED FUNKTIONSHINDER ELLER

NEDSATT RÖRLIGHET ENLIGT ARTIKEL 8

1.När det hänvisas till denna bilaga ska personer med funktionshinder eller nedsatt rörlighet få möjlighet att välja mellan följande, nämligen

a)— återbetalning inom sju dagar i kontanter, genom elektronisk banköverföring, bankgirering eller bankcheck motsvarande biljettens hela inköpspris, för den eller de delar av resan som inte har verkställts och för den eller de delar som redan har verkställts om resan inte längre tjänar något syfte i förhållande till passagerarens ursprungliga resplan, samt, där det är relevant,

— en returtransport till den första avresepunkten, vid första möjliga tillfälle, eller

b)ombokning till en resa till slutdestinationen enligt transportavtalet så snart som möjligt med jämförbara villkor och utan extra kostnad, eller

c)ombokning till en resa till slutdestinationen enligt transportavtalet med jämförbara villkor vid ett senare datum enligt passagerarens val och beroende på tillgången på biljetter.

2.Punkt 1 a ska också gälla för passagerare vars resa utgör en del av ett paket, utom vad gäller rätten till ersättning när en sådan rätt uppstår enligt direktiv 90/314/EEG.

3.När en stad eller en region har flera hamnar och en transportör erbjuder en passagerare en resa till en annan hamn än den som bokningen avsåg, ska transportören stå för kostnaderna för transport av passageraren från denna andra hamn antingen till den hamn som reservationen gällde eller till en annan närliggande destination som överenskommits med passageraren.

L 334/14

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

BILAGA II

ASSISTANS I HAMNAR, INKLUSIVE OMBORDSTIGNING OCH LANDSTIGNING, ENLIGT ARTIKLARNA 10

OCH 13

1.Den assistans och de arrangemang som är nödvändiga för att personer med funktionshinder eller nedsatt rörlighet ska kunna

anmäla sin ankomst till en hamnterminal eller, om det är möjligt, en hamn, och sin begäran om assistans,

förflytta sig från en ankomstpunkt till incheckningen, om sådan finns, eller till fartyget,

checka in och registrera bagage, om nödvändigt,

förflytta sig från incheckningsdisken, om sådan finns, till fartyget, genom utrese- och säkerhetskontrollerna,

gå ombord på fartyget, med hjälp av hissar, rullstolar eller annan assistans som i förekommande fall kan behövas,

förflytta sig från fartygets dörr till sina sittplatser/områden,

förvara och hämta sitt bagage på fartyget,

förflytta sig från sina sittplatser till fartygets dörr,

stiga i land från fartyget, med hjälp av hissar, rullstolar eller annan assistans som i förekommande fall kan behövas,

hämta bagage, om nödvändigt, och fortsätta genom inrese- och tullkontrollerna,

förflytta sig från bagagehallen eller landstigningspunkten till en angiven utgång,

ta sig till toaletten (om sådan finns) om så är nödvändigt.

2.När en person med funktionshinder eller nedsatt rörlighet åtföljs av en ledsagare måste den personen på begäran ges tillfälle att ge den assistans som behövs i hamnen och vid ombordstigning och landstigning.

3.Hantering av all nödvändig rörlighetsutrustning, inklusive utrustning såsom elektriska rullstolar.

4.Tillfällig ersättning av skadade eller förlorade rörelsehjälpmedel med hjälpmedel som utgör ett lämpligt alternativ.

5.Hantering av erkända ledarhundar, i förekommande fall.

6.Förmedling, i tillgänglig form, av den information som behövs för ombordstigning och landstigning.

17.12.2010

SV

Europeiska unionens officiella tidning

L 334/15

 

 

 

 

BILAGA III

ASSISTANS OMBORD PÅ FARTYG ENLIGT ARTIKLARNA 10 OCH 13

1.Transport av erkända ledarhundar ombord på fartyget, med förbehåll för nationella bestämmelser.

2.Transport av medicinsk utrustning och de rörelsehjälpmedel som är nödvändiga för personen med funktionshinder eller nedsatt rörlighet, inbegripet elektriska rullstolar.

3.Förmedling av väsentlig reseinformation i tillgänglig form.

4.Alla rimliga ansträngningar för att anpassa sittplatsen så att behoven för personer med funktionshinder eller nedsatt rör­ lighet på begäran tillgodoses, med förbehåll för säkerhetskrav och tillgång.

5.Assistans för att ta sig till toaletten (om sådan finns) om så är nödvändigt.

6.Om en person med funktionshinder eller nedsatt rörlighet assisteras av en ledsagare ska transportföretaget göra alla rim­ liga ansträngningar för att ledsagaren ska få en sittplats eller hytt bredvid personen med funktionshinder eller nedsatt rörlighet.

L 334/16

SV

Europeiska unionens officiella tidning

17.12.2010

 

 

 

 

BILAGA IV

UTBILDNING, INKLUSIVE INSTRUKTIONER, OM FUNKTIONSHINDER ENLIGT ARTIKEL 14

A. Utbildning, inklusive instruktioner, för att höja medvetenheten rörande funktionshinder

Utbildning, inklusive instruktioner, för att höja medvetenheten rörande funktionshinder ska innehålla följande:

Åtgärder för att höja medvetenheten om och lämpligt bemötande av passagerare med fysiska eller sensoriska hin­ der (hörsel och syn), dolda svårigheter eller inlärningssvårigheter, inklusive hur man skiljer mellan olika förmågor hos personer vars rörlighet eller orienterings- eller kommunikationsförmåga kan vara nedsatt.

De hinder som personer med funktionshinder eller nedsatt rörlighet stöter på, inbegripet attitydmässiga, miljö­ mässiga, fysiska och organisatoriska hinder.

Erkända ledarhundar, inbegripet deras roll och behovet av ledarhund.

Hantering av oförutsedda händelser.

Kunskap om mänskligt beteende och metoder för kommunikation med personer med nedsatt hörsel, nedsatt syn eller talsvårigheter och personer med inlärningssvårigheter.

Allmän kunskap om IMO:s riktlinjer avseende rekommendationen om anpassning av passagerarfartyg med hän­ syn till äldre personer och personer med funktionshinder.

B. Utbildning av, inklusive instruktioner till, personal som ger assistans till personer med funktionshinder

Utbildning av, inklusive instruktioner till, personal som ger assistans till personer med funktionshinder innehåller följande:

Hur man kan hjälpa rullstolsanvändare att ta sig i och ur en rullstol.

Hur man ger assistans till personer med funktionshinder eller nedsatt rörlighet som reser med en erkänd ledar­ hund, inbegripet en sådan hunds roll och behov.

Tekniker för ledsagning av passagerare med nedsatt syn och för hantering och transport av erkända ledarhundar.

Förståelse av de typer av utrustning som personer med funktionshinder eller nedsatt rörlighet använder som hjälp och kunskap om aktsam hantering av sådan utrustning.

Användning av den gällande utrustningen för assistans vid ombordstigning och landstigning och kunskap om de lämpliga assistansförfaranden vid ombordstigning och landstigning som är avsedda att trygga säkerheten och vär­ digheten för personer med funktionshinder eller nedsatt rörlighet.

Förståelse för behovet av tillförlitlig och professionell assistans. Även medvetenhet om det faktum att vissa perso­ ner med funktionshinder eller nedsatt rörlighet kan uppleva sig som sårbara under resan på grund av deras bero­ ende av den assistans som ges.

Kunskaper om första hjälpen.

28.2.2011

 

SV

Europeiska unionens officiella tidning

L 55/1

 

 

 

 

 

I

(Lagstiftningsakter)

FÖRORDNINGAR

EUROPAPARLAMENTETS OCH RÅDETS FÖRORDNING (EU) nr 181/2011 av den 16 februari 2011

om passagerares rättigheter vid busstransport och om ändring av förordning (EG) nr 2006/2004

(Text av betydelse för EES)

EUROPAPARLAMENTET OCH EUROPEISKA UNIONENS RÅD HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om Europeiska unionens funktions­ sätt, särskilt artikel 91.1,

(3)Unionens åtgärder för att förbättra passagerares rättighe­ ter inom busstransportsektorn bör ta hänsyn till de sär­ skilda förhållanden som råder inom denna sektor, vilken till stor del består av små och medelstora företag.

med beaktande av Europeiska kommissionens förslag,

med beaktande av Europeiska ekonomiska och sociala kommit­ téns yttrande (1),

efter att ha hört av Regionkommittén,

i enlighet med det ordinarie lagstiftningsförfarandet, på grundval av det gemensamma utkast som förlikningskommittén god­ kände den 24 januari 2011 (2), och

av följande skäl:

(1)Unionens insatser på busstransportområdet bör bland annat syfta till att säkerställa ett långtgående skydd för passagerarna, som är jämförbart med det som gäller för andra transportsätt, oavsett var de reser. Dessutom bör de allmänna konsumentskyddskraven beaktas fullt ut.

(2)Eftersom busspassageraren är den svagare parten i ett transportavtal bör alla passagerare tillerkännas en lägsta skyddsnivå.

(1) EUT C 317, 23.12.2009, s. 99.

(2) Europaparlamentets ståndpunkt av den 23 april 2009 (EUT C 184 E, 8.7.2010, s. 312), rådets ståndpunkt vid första behandlingen av den 11 mars 2010 (EUT C 122 E, 11.5.2010, s. 1), Europaparlamentets ståndpunkt av den 6 juli 2010 (ännu ej offentliggjord i EUT), rådets beslut av den 31 januari 2011 och Europaparlamentets lagstiftnings­ resolution av den 15 februari 2011 (ännu ej offentliggjord i EUT).

(4)Passagerare samt åtminstone personer som passageraren hade, eller skulle ha haft, en rättslig skyldighet att försörja bör åtnjuta tillräckligt skydd i händelse av olyckor som inträffar till följd av användning av bussen, med beak­ tande av Europaparlamentets och rådets direktiv 2009/103/EG av den 16 september 2009 om ansvars­ försäkring för motorfordon och kontroll av att försäk­ ringsplikten fullgörs beträffande sådan ansvarighet (3).

(5)Vid valet av tillämplig nationell lag i fråga om ersättning vid dödsfall, inbegripet skäliga begravningskostnader, el­ ler personskada samt för förlust av eller skada på bagage på grund av olyckor som inträffar till följd av användning av bussen bör Europaparlamentets och rådets förordning (EG) nr 864/2007 av den 11 juli 2007 om tillämplig lag för utomobligatoriska förpliktelser (Rom II) (4) och Euro­ paparlamentets och rådets förordning (EG) nr 593/2008 av den 17 juni 2008 om tillämplig lag för avtalsförplik­ telser (Rom I) (5) beaktas.

(6)Utöver ersättning i enlighet med tillämplig nationell lag i händelse av dödsfall eller personskada eller förlust av eller skada på bagage till följd av olyckor som inträffar vid användning av bussen bör passagerare ha rätt till assis­ tans i fråga om omedelbara praktiska behov efter en olycka. Sådan assistans bör vid behov innefatta första hjälpen, inkvartering, mat, kläder och transport.

(3) EUT L 263, 7.10.2009, s. 11. (4) EUT L 199, 31.7.2007, s. 40. (5) EUT L 177, 4.7.2008, s. 6.

L 55/2

SV

Europeiska unionens officiella tidning

28.2.2011

 

 

 

 

 

(7)Persontrafiktjänster med buss bör gagna allmänheten. Personer med funktionshinder eller nedsatt rörlighet, oav­ sett om orsaken utgörs av funktionsnedsättning, ålder eller andra faktorer, bör därför ha möjligheter att resa med buss som är jämförbara med andra medborgares. Personer med funktionshinder eller nedsatt rörlighet har samma rättigheter som andra medborgare med avseende på fri rörlighet, valfrihet och icke-diskriminering.

(8)Mot bakgrund av artikel 9 i Förenta nationernas konven­ tion om rättigheter för personer med funktionsnedsätt­ ning, och för att ge personer med funktionshinder och personer med nedsatt rörlighet likvärdiga möjligheter som andra medborgare att resa med buss, bör bestäm­ melser om icke-diskriminering och assistans under resan införas. Dessa personer bör därför ges tillgång till trans­ porter och inte vägras resa på grund av deras funktions­ hinder eller nedsatta rörlighet, utom när detta är motive­ rat av säkerhetsskäl eller på grund av fordonens eller infrastrukturens utformning. Inom ramen för relevant lagstiftning till skydd för arbetstagare bör personer med funktionshinder och personer med nedsatt rörlighet ha rätt till assistans i terminaler och ombord på bussar. För att främja social delaktighet bör personerna i fråga få assistans utan extra kostnad. Transportörerna bör fast­ ställa villkor för tillgänglighet, helst med användning av det europeiska standardiseringssystemet.

(9)När beslut fattas om utformningen av nya terminaler, och i samband med omfattande renovering, bör terminal­ operatörer sträva efter att ta hänsyn till behoven hos personer med funktionshinder och personer med nedsatt rörlighet, i enlighet med kraven på design för alla. Ter­ minaloperatörer bör under alla omständigheter utse plat­ ser där dessa personer kan anmäla sin ankomst och sitt behov av assistans.

(10)På liknande sätt bör transportörer, utan att det påverkar tillämpningen av befintlig eller framtida lagstiftning om tekniska krav på bussar, när det är möjligt ta hänsyn till dessa behov när de fattar beslut om utrustningen i nya och nyrenoverade fordon.

(11)Medlemsstaterna bör sträva efter att förbättra befintlig infrastruktur när detta är nödvändigt för att transportörer ska kunna säkerställa tillträde för personer med funk­

tionshinder eller personer med nedsatt rörlighet samt för att ge lämplig assistans.

(12)För att tillgodose de behov som personer med funktions­ hinder och personer med nedsatt rörlighet har bör per­ sonalen få lämplig utbildning. För att underlätta ömsesi­ digt erkännande av förares nationella kvalifikationer kan utbildning rörande medvetenhet om funktionshinder ingå i den grundläggande kompetens eller fortbildning som

avses i Europaparlamentets och rådets direktiv 2003/59/EG av den 15 juli 2003 om grundläggande kompetens och fortbildning för förare av vissa vägfordon för gods- eller persontransport (1). För att säkerställa sam­ stämmighet mellan införandet av utbildningskraven och de tidsfrister som anges i direktivet bör en möjlighet till undantag under en begränsad tidsperiod tillåtas.

(13)Organisationer som företräder personer med funktions­ hinder eller personer med nedsatt rörlighet bör konsul­ teras eller medverka när innehållet i utbildning om funk­ tionshinder utformas.

(14)Busspassagerares rättigheter bör omfatta mottagande av information om tjänsten före och under resan. All infor­ mation av betydelse som lämnas till busspassagerare bör också på begäran lämnas i alternativa former som är tillgängliga för personer med funktionshinder och perso­ ner med nedsatt rörlighet, såsom stor skrift, enkelt språk, blindskrift, elektronisk kommunikation som kan använ­ das med anpassad teknik eller ljudinspelningar.

(15)Denna förordning bör inte begränsa transportörernas rätt att begära kompensation från någon, däribland tredje man, i enlighet med tillämplig nationell lag.

(16)Passagerarnas olägenhet på grund av att resan ställs in eller försenas väsentligt bör begränsas. Passagerare som reser från terminaler bör därför bli omhändertagna på lämpligt sätt och informeras på ett sätt som är tillgängligt för alla passagerare. Passagerare bör också ges möjlighet att avboka resan och få biljettkostnaden återbetald eller fortsätta sin resa eller bli ombokade på tillfredsställande villkor. Om transportörer underlåter att ge passagerare nödvändig assistans bör passagerarna ha rätt till ekono­ misk ersättning.

(17)Transportörer bör, med medverkan av intressenter, branschorganisationer och sammanslutningar för kunder, passagerare, personer med funktionshinder och personer med nedsatt rörlighet, samarbeta för att anta bestämmel­ ser på nationell eller europeisk nivå. Sådana bestämmel­ ser bör syfta till att förbättra informationen, omsorgen om och assistansen till passagerarna när deras resa av­ bryts, särskilt vid stora förseningar eller inställda turer, och speciellt uppmärksamma passagerare med särskilda behov till följd av funktionshinder, nedsatt rörlighet, sjukdom, hög ålder och graviditet och inbegripa deras ledsagare samt passagerare som reser med små barn. Nationella tillsynsorgan bör informeras om dessa bestäm­ melser.

(1) EUT L 226, 10.9.2003, s. 4.

28.2.2011

 

SV

Europeiska unionens officiella tidning

L 55/3

 

 

 

 

 

(18)Denna förordning bör inte påverka passagerares rättighe­ ter enligt rådets direktiv 90/314/EEG av den 13 juni 1990 om paketresor, semesterpaket och andra paket­ arrangemang (1). Denna förordning bör inte tillämpas i fall då en paketresa ställs in av andra orsaker än att busstransporttjänsten ställs in.

(19)Passagerarna bör få fullständig information om sina rät­ tigheter enligt denna förordning så att de faktiskt kan utöva dessa rättigheter.

(20)Passagerarna bör kunna utöva sina rättigheter med hjälp av lämpliga klagomålsförfaranden som inrättats av trans­ portörerna eller, i förekommande fall, genom att lämna klagomål till det eller de organ som medlemsstaten i fråga har utsett för detta ändamål.

(21)Medlemsstaterna bör se till att denna förordning följs och utse ett eller flera behöriga organ för tillsyn och kontroll av efterlevnaden. Detta påverkar inte passagerares rätt att få sin sak prövad i domstol i enlighet med nationell lag.

(22)Med beaktande av de förfaranden som medlemsstater har inrättat för inlämnande av klagomål bör ett klagomål som gäller assistans företrädesvis riktas till det eller de organ som har utsetts för att se till att denna förordning efterlevs i den medlemsstat där platsen för påstigning eller avstigning är belägen.

(23)Medlemsstaterna bör främja utnyttjande av kollektivtrafik samt användning av samordnad information och sam­ ordnade biljetter för att optimera utnyttjande av och kompatibilitet mellan olika transportslag och operatörer.

(24)Medlemsstaterna bör fastställa sanktioner vid överträdel­ ser av bestämmelserna i denna förordning och se till att sanktionerna tillämpas. Dessa sanktioner bör vara effek­ tiva, proportionella och avskräckande.

(25)Eftersom målet för denna förordning, nämligen att säker­ ställa en likvärdig nivå för skydd och assistans för pas­ sagerare vid busstransporter i alla medlemsstater, inte i tillräcklig utsträckning kan uppnås av medlemsstaterna och det därför, på grund av åtgärdens omfattning och verkningar, bättre kan uppnås på unionsnivå, kan unio­ nen vidta åtgärder i enlighet med subsidiaritetsprincipen i artikel 5 i fördraget om Europeiska unionen. I enlighet med proportionalitetsprincipen i samma artikel går denna förordning inte utöver vad som är nödvändigt för att uppnå detta mål.

(26)Denna förordning bör inte påverka tillämpningen av Eu­ ropaparlamentets och rådets direktiv 95/46/EG av den 24 oktober 1995 om skydd för enskilda personer med

(1) EGT L 158, 23.6.1990, s. 59.

avseende på behandling av personuppgifter och om det fria flödet av sådana uppgifter (2).

(27)Genomförandet av denna förordning bör grundas på Eu­

ropaparlamentets och rådets förordning (EG) nr 2006/2004 av den 27 oktober 2004 om samarbete mellan de nationella tillsynsmyndigheter som ansvarar för konsumentskyddslagstiftningen (förordningen om konsumentskyddssamarbete) (3). Den förordningen bör därför ändras i enlighet med detta.

(28)Denna förordning står i överensstämmelse med de grundläggande rättigheter och principer som erkänns sär­ skilt i Europeiska unionens stadga om de grundläggande rättigheterna, vilken det hänvisas till i artikel 6 i fördraget om Europeiska unionen, och beaktar även rådets direktiv 2000/43/EG av den 29 juni 2000 om genomförandet av principen om likabehandling av personer oavsett deras ras eller etniska ursprung (4) och rådets direktiv 2004/113/EG av den 13 december 2004 om genom­ förande av principen om likabehandling av kvinnor och män när det gäller tillgång till och tillhandahållande av varor och tjänster (5).

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

KAPITEL I

ALLMÄNNA BESTÄMMELSER

Artikel 1

Syfte

I denna förordning fastställs regler för busstransporter på föl­ jande områden:

a)Icke-diskriminering mellan passagerare när det gäller de transportvillkor som transportörerna erbjuder.

b)Passagerares rättigheter i händelse av olyckor som inträffar till följd av användning av bussen och som leder till dödsfall eller personskada eller till förlust av eller skada på bagage.

c)Icke-diskriminering av och obligatorisk assistans till personer med funktionshinder och personer med nedsatt rörlighet.

d)Passagerares rättigheter vid inställda resor eller förseningar.

e)Minsta information som ska lämnas till passagerarna.

f)Hantering av klagomål.

g)Allmänna regler om kontroll av efterlevnaden.

(2) EGT L 281, 23.11.1995, s. 31. (3) EUT L 364, 9.12.2004, s. 1. (4) EGT L 180, 19.7.2000, s. 22. (5) EUT L 373, 21.12.2004, s. 37.

L 55/4

SV

Europeiska unionens officiella tidning

28.2.2011

 

 

 

 

 

Artikel 2

Tillämpningsområde

1.Denna förordning ska tillämpas på passagerare som reser med linjetrafik för icke specificerade passagerarkategorier när passagerarens påstigningsplats eller avstigningsplats är belägen inom en medlemsstats territorium och när transportsträckan enligt tidtabell är 250 km eller längre.

2.När det gäller de transporttjänster som avses i punkt 1 men där transportsträckan enligt tidtabell understiger 250 km ska artiklarna 4.2, 9, 10.1, 16.1 b, 16.2, 17.1, 17.2 och 24–28 tillämpas.

3.Dessutom ska denna förordning, med undantag för artik­ larna 9–16 och 17.3 och kapitlen IV, V och VI, tillämpas på passagerare som reser med tillfällig trafik om passagerarens

första påstigningsplats eller slutliga avstigningsplats ligger inom en medlemsstats territorium.

4.Med undantag för artiklarna 4.2, 9, 10.1, 16.1 b, 16.2, 17.1, 17.2 och 24–28 får medlemsstaterna på tydliga och icke- diskriminerande grunder undanta inrikes linjetrafik från tillämp­ ningen av denna förordning. Sådana undantag får beviljas från och med den dag då denna förordning börjar tillämpas under en tid av högst fyra år, och får förnyas en gång.

5.Under en tid av högst fyra år från och med den dag då denna förordning börjar tillämpas får medlemsstaterna på klara, tydliga och icke-diskriminerande grunder undanta viss linjetrafik från tillämpningen av bestämmelserna i denna förordning av det skälet att en betydande del av denna linjetrafik, inbegripet minst ett uppehåll enligt tidtabell, tillhandahålls utanför unionen. Så­ dana undantag får förnyas en gång.

6.Medlemsstaterna ska underrätta kommissionen om undan­ tag för olika typer av trafik som beviljas i enlighet med punk­ terna 4 och 5. Kommissionen ska vidta lämpliga åtgärder om ett sådant undantag inte anses förenligt med bestämmelserna i denna artikel. Senast den 2 mars 2018 ska kommissionen före­ lägga Europaparlamentet och rådet en rapport om de undantag som beviljats enligt punkterna 4 och 5.

7.Ingenting i denna förordning ska anses stå i konflikt med eller införa ytterligare krav utöver befintlig lagstiftning om tek­ niska krav på bussar eller infrastruktur eller utrustning vid buss­ hållplatser och terminaler.

8.Denna förordning ska inte påverka passagerares rättigheter enligt direktiv 90/314/EEG och ska inte tillämpas i fall då en paketresa som avses i det direktivet ställs in av andra skäl än inställd linjetrafik.

Artikel 3

Definitioner

I denna förordning gäller följande definitioner:

a)linjetrafik: persontransport med buss vid regelbundna tider längs bestämda färdvägar, varvid passagerarna får stiga på och av vid i förväg bestämda hållplatser,

b)tillfällig trafik: trafik som inte utgör linjetrafik, och som huvudsakligen kännetecknas av transport med buss av pas­ sagerargrupper som har bildats på initiativ av kunden eller transportören,

c)transportavtal: ett avtal om transport mellan en transportör och en passagerare om tillhandahållande av en eller flera transporter med linjetrafik eller tillfällig trafik,

d)biljett: en giltig färdhandling eller annat bevis på transport­ avtal,

e)transportör: en fysisk eller juridisk person, som inte är en researrangör, en resebyrå eller en biljettutfärdare, som er­ bjuder allmänheten transport medelst linjetrafik eller till­ fällig trafik,

f)utförande transportör: en annan fysisk eller juridisk person än transportören vilken faktiskt utför hela eller en del av transporten,

g)biljettutfärdare: varje mellanhand som ingår transportavtal för en transportörs räkning,

h)resebyrå: varje mellanhand som agerar för en passagerares räkning vid ingående av transportavtal,

i)researrangör: en annan arrangör eller återförsäljare än trans­ portören, i den mening som avses i artikel 2.2 och 2.3 i direktiv 90/314/EEG,

j)person med funktionshinder eller person med nedsatt rörlighet: en person vars rörlighet är nedsatt vid användning av trans­ porter på grund av någon form av fysiskt funktionshinder (sensoriskt eller motoriskt, bestående eller tillfälligt), psy­ kiskt funktionshinder eller psykisk funktionsnedsättning eller på grund av annat funktionshinder eller ålder och vars situation kräver lämplig uppmärksamhet och anpass­ ning till denna persons särskilda behov av de tjänster som är tillgängliga för alla passagerare,

28.2.2011

 

SV

Europeiska unionens officiella tidning

L 55/5

 

 

 

 

 

k)villkor för tillgänglighet: relevanta normer och riktlinjer för samt relevant information om tillgängligheten till bussar och/eller till utsedda terminaler, inbegripet deras installa­ tioner för personer med funktionshinder eller nedsatt rör­ lighet,

l)bokning: en bokning av en plats på en buss i linjetrafik som avser en specifik avgång,

m)terminal: en bemannad terminal där en buss i linjetrafik enligt tidtabellen för en angiven färdväg ska stanna för på- och avstigning av passagerare och som är utrustad med inrättningar som incheckningsdisk, väntsal eller bil­ jettkontor,

n)busshållplats: en plats som inte är en terminal och där en buss i linjetrafik enligt tidtabellen för den angivna färdvä­ gen ska stanna för på- och avstigning av passagerare,

o)terminaloperatör: en organisatorisk enhet i en medlemsstat som ansvarar för administrationen och skötseln av en ut­ sedd terminal,

p)inställd resa: en resa i linjetrafik som inte genomförts trots att den i förväg angivits i tidtabellen,

q)försening: skillnaden mellan den tidtabellsenliga avgångs­ tiden för en buss i linjetrafik och den verkliga avgångs­ tiden.

Artikel 4

Biljetter och icke-diskriminerande avtalsvillkor

1.Transportörer ska utfärda en biljett till passageraren, så­ vida inte andra handlingar ger rätt till transport. En biljett får utfärdas i elektroniskt format.

2.Utan att det påverkar subventionerade taxor ska de avtals­ villkor och taxor som tillämpas av transportörer erbjudas all­ mänheten utan någon direkt eller indirekt diskriminering på grundval av den slutlige kundens nationalitet eller etablering­ sorten för transportörerna, eller biljettutfärdare inom unionen.

Artikel 5

Andra utförande parter

1.Transportörer, resebyråer, researrangörer eller terminal­ operatörer som anförtrott en utförande transportör, en biljett­ utfärdare eller någon annan person att fullgöra de skyldigheter som anges i denna förordning ska ändå vara ansvariga för den utförande partens handlande eller underlåtenhet.

2.Dessutom ska den part som transportören, resebyrån, re­ searrangören eller terminaloperatören har anförtrott att fullgöra

en skyldighet även omfattas av bestämmelserna i denna förord­ ning med avseende på den skyldighet som anförtrotts.

Artikel 6

Ansvarsbegränsning

1.Skyldigheter gentemot passagerare enligt denna förordning får inte begränsas eller åsidosättas, i synnerhet inte genom un­ dantag eller begränsande restriktioner i transportavtalet.

2.Transportörerna får erbjuda avtalsvillkor som är gynnsam­ mare för passagerarna än de villkor som fastställs i denna för­ ordning.

KAPITEL II

ERSÄTTNING OCH ASSISTANS I HÄNDELSE AV OLYCKOR

Artikel 7

Dödsfall eller personskada som drabbar passagerare samt förlorat eller skadat resgods

1.Passagerare ska, i enlighet med tillämplig nationell lag, ha rätt till ersättning vid dödsfall, inbegripet skäliga begravnings­ kostnader, eller vid personskada och för resgods som förlorats eller skadats på grund av olyckor som inträffar till följd av användning av bussen. I händelse av en passagerares död ska denna rätt åtminstone gälla för de personer mot vilka passage­ raren var, eller skulle ha blivit, underhållsskyldig.

2.Ersättningsbeloppet ska beräknas i enlighet med tillämplig nationell lag. Eventuella i nationell lag föreskrivna maximibe­ lopp för ersättning vid dödsfall och personskada eller förlorat eller skadat bagage ska i varje enskilt fall inte understiga

a)220 000 EUR per passagerare,

b)1 200 EUR per kolli. I händelse av skada på rullstolar, annan rörlighetsutrustning eller hjälpmedel ska ersättningsbeloppet alltid uppgå till kostnaden för att ersätta eller reparera den förlorade eller skadade utrustningen.

Artikel 8

Passagerares omedelbara praktiska behov

I händelse av en olycka som inträffar till följd av användning av bussen ska transportören tillhandahålla rimlig och proportionell assistans med avseende på passagerarnas omedelbara praktiska behov efter olyckan. Sådan assistans ska vid behov innefatta inkvartering, mat, kläder, transport och tillhandahållande av första hjälpen. Tillhandahållande av assistans ska inte innebära ett erkännande av skadeståndsansvar.

Transportören får, för varje passagerare, begränsa den totala kostnaden för inkvartering till 80 EUR per natt och inkvarte­ ringens längd till maximalt två nätter.

L 55/6

SV

Europeiska unionens officiella tidning

28.2.2011

 

 

 

 

 

KAPITEL III

RÄTTIGHETER FÖR PERSONER MED FUNKTIONSHINDER

OCH PERSONER MED NEDSATT RÖRLIGHET

Artikel 9

Rätt till transport

1.Transportörer, resebyråer och researrangörer får inte vägra att godkänna en bokning från, vägra att utfärda eller på annat sätt tillhandahålla en biljett till, eller vägra att släppa ombord en person med hänvisning till funktionshinder eller nedsatt rörlig­ het.

2.Bokningar och biljetter ska utan extra kostnad erbjudas personer med funktionshinder och personer med nedsatt rörlig­ het.

Artikel 10

Undantag och särskilda villkor

1. Utan hinder av artikel 9.1 får transportörer, resebyråer eller researrangörer vägra att godkänna en bokning från, vägra att utfärda eller på annat sätt tillhandahålla en biljett till, eller vägra att släppa ombord en person med hänvisning till funk­ tionshinder eller nedsatt rörlighet

a)för att uppfylla tillämpliga säkerhetskrav som fastställts i internationell rätt, unionsrätt eller nationell rätt eller för att uppfylla säkerhetskrav som fastställts av behöriga myndighe­ ter,

b)i de fall då utformningen av fordonet eller infrastrukturen, inbegripet busshållplatser och terminaler, fysiskt omöjliggör påstigning, avstigning eller transport av personen med funk­ tionshinder eller nedsatt rörlighet på ett säkert och för drif­ ten lämpligt sätt.

2.Om en vägran att godkänna en bokning eller att utfärda eller att på annat sätt tillhandahålla en biljett grundas på de skäl som anges i punkt 1, ska transportörer, resebyråer och rese­ arrangörer informera den berörda personen om alla eventuella godtagbara alternativa transporter som transportören utför.

3.Om en person med funktionshinder eller nedsatt rörlighet som har en bokning eller en biljett och som uppfyllt kraven i artikel 14.1 a ändå, på grund av sitt funktionshinder eller sin nedsatta rörlighet, nekas påstigning, ska denne och eventuella ledsagare i enlighet med punkt 4 i den här artikeln ges möjlig­ het att välja mellan

a)rätt till ersättning och, i förekommande fall, en kostnadsfri returresa till första avreseplatsen enligt transportavtalet så snart som möjligt och

b)med undantag för de fall då det inte är praktiskt möjligt, fortsatt resa eller ombokning till rimlig alternativ transport till den bestämmelseort som anges i transportavtalet.

Rätten till återbetalning av de pengar som betalats för biljetten ska inte påverkas av underlåtenhet att lämna meddelande i enlighet med artikel 14.1 a.

4. Om en transportör, resebyrå eller researrangör vägrar att godkänna en bokning från, utfärda eller på annat sätt tillhan­ dahålla en biljett till, eller släppa ombord en person på grund av funktionshinder eller nedsatt rörlighet i enlighet med de skäl som anges i punkt 1, får den personen begära att få ledsagas av en annan person som han eller hon väljer själv, som kan ge den assistans som personen med funktionshinder eller nedsatt rörlighet kräver, så att de skäl som anges i punkt 1 inte längre är tillämpliga.

En sådan ledsagare ska transporteras utan kostnad och, när det är praktiskt möjligt, ges en plats bredvid personen med funk­ tionshinder eller nedsatt rörlighet.

5. I de fall då transportörer, resebyråer eller researrangörer tillämpar bestämmelserna i punkt 1, ska de omedelbart infor­ mera personen med funktionshinder eller nedsatt rörlighet om anledningen till detta och, på begäran, skriftligen informera personen i fråga inom fem arbetsdagar efter begäran.

Artikel 11

Tillgänglighet och information

1.I samarbete med organisationer som företräder personer med funktionshinder eller personer med nedsatt rörlighet ska transportörer och terminaloperatörer, eventuellt genom sina or­ ganisationer, ha eller fastställa icke-diskriminerande villkor för tillgänglighet med avseende på transport av personer med funk­ tionshinder och personer med nedsatt rörlighet.

2.De villkor för tillgänglighet som anges i punkt 1, inbegri­ pet texten till internationell rätt, unionsrätt eller nationell rätt i vilken säkerhetskraven fastställts, som ligger till grund för dessa icke-diskriminerande villkor för tillgänglighet, ska tillhandahållas allmänheten av transportörer och terminaloperatörer fysiskt el­ ler på Internet, på begäran i tillgänglig form, på samma språk som det på vilket information i allmänhet görs tillgänglig för alla passagerare. När denna information tillhandahålls ska sär­ skild vikt läggas vid behoven hos personer med funktionshinder eller nedsatt rörlighet.

3.Researrangörer ska tillhandahålla de villkor för tillgänglig­ het som anges i punkt 1 och som tillämpas på resor som ingår i paketresor, semesterpaket och andra paketarrangemang som de organiserar, säljer eller erbjuder till försäljning.

4.Den information om villkor för tillgänglighet som avses i punkterna 2 och 3 ska på passagerarens begäran delas ut i fysisk form.

28.2.2011

 

SV

Europeiska unionens officiella tidning

L 55/7

 

 

 

 

 

5. Transportörer, resebyråer och researrangörer ska se till att all relevant allmän information om resan och transportvillkoren finns att tillgå i en form som lämpar sig och är tillgänglig för personer med funktionshinder eller nedsatt rörlighet, inbegripet, i förekommande fall, vid bokning och information på Internet. Informationen ska på passagerarens begäran delas ut i fysisk form.

Artikel 12

Utseende av terminaler

Medlemsstaterna ska utse bussterminaler där assistans för per­ soner med funktionshinder och personer med nedsatt rörlighet ska tillhandahållas. Medlemsstaterna ska underrätta kommissio­ nen om detta. Kommissionen ska tillhandahålla en förteckning över de utsedda bussterminalerna på Internet.

Artikel 13

Rätt till assistans på utsedda terminaler och ombord på bussar

1.Med förbehåll för de villkor för tillgänglighet som anges i artikel 11.1 ska transportörer och terminaloperatörer, inom sina respektive behörighetsområden, på terminaler som utsetts av medlemsstater, utan kostnad tillhandahålla personer med funk­ tionshinder och personer med nedsatt rörlighet åtminstone den assistans som anges i bilaga I del a.

2.Med förbehåll för de villkor för tillgänglighet som anges i artikel 11.1 ska transportörer ombord på bussar utan kostnad tillhandahålla personer med funktionshinder och personer med nedsatt rörlighet åtminstone den assistans som anges i bilaga I del b.

Artikel 14

Villkor för assistans

1. Transportörer och terminaloperatörer ska samarbeta för att tillhandahålla personer med funktionshinder och personer med nedsatt rörlighet assistans på villkor att

a)personens behov av sådan assistans meddelas transportörer, terminaloperatörer, resebyråer eller researrangörer senast 36 timmar innan assistansen behövs, och

b)personerna i fråga infinner sig på angiven plats

i)vid den tidpunkt som i förväg angivits av transportören, dock inte mer än 60 minuter före angiven avgångstid, såvitt inte transportören och passageraren har kommit överens om en kortare tidsperiod, eller

ii)om ingen tidpunkt har angivits, senast 30 minuter före angiven avgångstid.

2. Utöver punkt 1 ska personer med funktionshinder eller nedsatt rörlighet vid tidpunkten för bokningen eller förhands­

köpet av biljetten meddela transportören, resebyrån eller rese­ arrangören om sina särskilda sittplatsbehov, förutsatt att detta behov är känt vid den tidpunkten.

3.Transportörer, terminaloperatörer, resebyråer och rese­ arrangörer ska vidta alla åtgärder som krävs för att underlätta mottagandet av meddelanden om behovet av assistans från per­ soner med funktionshinder eller nedsatt rörlighet. Denna skyl­ dighet ska gälla vid alla utsedda terminaler och deras försälj­ ningsställen, även vid telefon- och Internetförsäljning.

4.Om inget meddelande i enlighet med punkterna 1 a och 2 lämnas ska transportörer, terminaloperatörer, resebyråer och researrangörer så långt det kan anses vara rimligt se till att personen med funktionshinder eller nedsatt rörlighet får den assistans som krävs för att han eller hon ska kunna stiga på en avgående buss, byta till en anslutande buss eller stiga av en ankommande buss under en resa för vilken han eller hon köpt biljett.

5.Terminaloperatören ska anvisa en plats i eller utanför ter­ minalen där personer med funktionshinder eller nedsatt rörlig­ het kan meddela sin ankomst och begära assistans. Platsen ska vara tydligt skyltad och vid denna ska finnas grundläggande information om terminalen och den assistans som tillhanda­ hålls, i en form som är tillgänglig för personen i fråga.

Artikel 15

Vidarebefordran av information till en tredje part

Om resebyråer eller researrangörer meddelas enligt artikel 14.1 a ska de, under sin normala kontorstid, snarast möjligt vidarebe­ fordra informationen till transportören eller terminaloperatören.

Artikel 16

Utbildning

1. Transportörer och, vid behov, terminaloperatörer ska in­ föra förfaranden för utbildning om funktionshinder, inbegripet instruktioner, och se till att

a)deras personal, med undantag av förare, inbegripet personer som anställts av någon annan utförande part, som ger direkt assistans till personer med funktionshinder och personer med nedsatt rörlighet, utbildas eller instrueras enligt bilaga II del a och del b, och

b)deras personal, inbegripet förare, som direkt har att göra med den resande allmänheten eller frågor som rör den re­ sande allmänheten, utbildas eller instrueras enligt beskriv­ ningen i bilaga II del a.

2. En medlemsstat får, för en längsta tidsperiod på fem år från och med den 1 mars 2013, bevilja undantag från tillämp­ ningen av punkt 1 b med avseende på utbildning av förare.

L 55/8

SV

Europeiska unionens officiella tidning

28.2.2011

 

 

 

 

 

Artikel 17

Ersättning avseende rullstolar och annan rörlighetsutrustning

1.Transportörer och terminaloperatörer ansvarar för förlust av och skada på rullstolar, annan rörlighetsutrustning eller hjälpmedel. Förlusten eller skadan ska ersättas av den transpor­ tör eller terminaloperatör som ansvarar för förlusten eller ska­ dan.

2.Den ersättning som avses i punkt 1 ska motsvara kost­ naden för att ersätta eller reparera den utrustning eller de hjälp­ medel som förlorats eller skadats.

3.Vid behov ska alla ansträngningar göras för att snabbt få fram tillfällig ersättningsutrustning eller tillfälliga ersättnings­ hjälpmedel. Rullstolar, annan rörlighetsutrustning eller hjälpme­ del ska om möjligt ha liknande tekniska och funktionsmässiga egenskaper som de som förlorats eller skadats.

Artikel 18

Undantag

1.Medlemsstater får, utan att det påverkar tillämpningen av artikel 2.2, i fråga om inrikes linjetrafik bevilja undantag från tillämpningen av alla eller vissa av bestämmelserna i detta ka­ pitel, under förutsättning att de säkerställer att nivån på skyddet för personer med funktionshinder och personer med nedsatt rörlighet enligt tillämpliga nationella bestämmelser åtminstone är likvärdig med nivån på skyddet enligt denna förordning.

2.Medlemsstaterna ska underrätta kommissionen om de un­ dantag som beviljas enligt punkt 1. Kommissionen ska vidta lämpliga åtgärder om ett sådant undantag inte anses förenligt med bestämmelserna i denna artikel. Senast den 2 mars 2018 ska kommissionen förelägga Europaparlamentet och rådet en rapport om undantag som beviljats enligt punkt 1.

KAPITEL IV

PASSAGERARES RÄTTIGHETER VID INSTÄLLD RESA ELLER

FÖRSENING

Artikel 19

Fortsatt resa, ombokning och återbetalning

1. Om en transportör på skäliga grunder kan anta att linje­ trafiken vid avgången från en terminal kommer att ställas in eller försenas med mer än 120 minuter, eller vid överbokning, ska passagerare omedelbart få välja mellan

a)fortsatt resa eller ombokning, utan extra kostnad, till en resa med jämförbara villkor enligt transportavtalet till slutdestina­ tionen så snart som möjligt,

b)återbetalning motsvarande biljettpriset och, i förekommande fall, en kostnadsfri returresa med buss till den första avre­ seplatsen enligt transportavtalet så snart som möjligt.

2.Om transportören underlåter att erbjuda passageraren det val som avses i punkt 1, ska passageraren ha rätt till ersättning som uppgår till 50 % av biljettpriset, utöver den återbetalning som avses i punkt 1 b. Detta belopp ska betalas av transportö­ ren inom en månad från det att begäran om ersättning läm­ nades in.

3.Om bussen under resan blir köroduglig ska transportören antingen tillhandahålla fortsatt resa med ett annat fordon från den plats där det körodugliga fordonet befinner sig, eller trans­ port från den plats där det körodugliga fordonet befinner sig till en lämplig väntplats eller terminal, varifrån resan kan fortsätta.

4.Om linjetrafiken vid avgången från en busshållplats ställs in eller försenas med mer än 120 minuter, ska passagerare ha rätt till sådan fortsatt resa eller ombokning eller återbetalning motsvarande biljettpriset från transportören, såsom avses i punkt 1.

5.Ersättning enligt punkterna 1 b och 4 ska betalas ut inom

14dagar efter det att erbjudandet gjorts eller en begäran tagits emot. Utbetalningen ska täcka biljettens hela inköpspris, för den eller de delar av resan som inte har genomförts och för den eller de delar som redan har genomförts om resan inte längre tjänar något syfte i förhållande till passagerarens ursprungliga resplan. I fråga om periodkort eller abonnemang ska betalningen mot­ svara dess proportionella andel av hela kostnaden för period­ kortet eller abonnemanget. Återbetalningen ska göras i pengar, såvida inte passageraren godtar någon annan form av återbetal­ ning.

Artikel 20

Information

1.Vid inställda eller försenade avgångar i linjetrafiken ska transportören eller, i förekommande fall, terminaloperatören underrätta de passagerare som reser från en terminal om situa­ tionen så snart som möjligt, dock senast 30 minuter efter den i tidtabellen angivna avgångstiden, och om den beräknade av­ gångstiden så snart som denna information finns tillgänglig.

2.Om passagerare missar en enligt tidtabellen anslutande transport på grund av en inställd eller försenad avgång, ska transportören och, i förekommande fall, terminaloperatören göra rimliga ansträngningar för att underrätta berörda passage­ rare om alternativa anslutningar.

3.Transportören eller, i förekommande fall, terminalopera­ tören ska se till att personer med funktionshinder och personer med nedsatt rörlighet får den information som krävs enligt punkterna 1 och 2 i tillgänglig form.

28.2.2011

 

SV

Europeiska unionens officiella tidning

L 55/9

 

 

 

 

 

4. När det är genomförbart ska den information som krävs enligt punkterna 1 och 2 tillhandahållas alla passagerare på elektronisk väg, inbegripet de passagerare som reser från buss­ hållplatser, inom den tidsgräns som föreskrivs i punkt 1, om passageraren har begärt detta och har tillhandahållit transportö­ ren de nödvändiga kontaktuppgifterna.

Artikel 21

Assistans vid inställda eller försenade avgångar

I fråga om resor som enligt tidtabellen överstiger tre timmar ska transportören vid en inställd eller mer än 90 minuter försenad avgång från en terminal kostnadsfritt erbjuda passageraren

a)snacks, måltider eller förfriskningar i skälig proportion till väntetiden eller förseningen, förutsatt att sådana finns att tillgå ombord på bussen eller i terminalen eller rimligen kan anskaffas,

b)hotellrum eller annan inkvartering samt assistans med att anordna transport mellan terminalen och inkvarteringen,

om det krävs en eller flera övernattningar. Transportören får, för varje passagerare, begränsa den totala kostnaden för inkvartering till 80 EUR per natt och inkvarteringens längd till maximalt två nätter, exklusive transport mellan terminalen och inkvarteringen.

Vid tillämpning av denna artikel ska transportören särskilt upp­ märksamma behoven hos personer med funktionshinder eller nedsatt rörlighet och deras eventuella ledsagare.

Artikel 22

Ytterligare anspråk

Ingenting i detta kapitel ska hindra passagerare från att begära skadestånd i enlighet med nationell lagstiftning vid nationella domstolar för skador med anledning av inställd eller försenad linjetrafik.

Artikel 23

Undantag

1.Artiklarna 19 och 21 ska inte tillämpas på passagerare med öppna biljetter så länge avgångstiden inte har specificerats, med undantag för passagerare som har ett abonnemang eller periodkort.

2.Artikel 21 b ska inte tillämpas när transportören bevisar att den inställda eller försenade avgången förorsakas av svåra väderleksförhållanden eller större naturkatastrofer som äventyrar säkra busstransporter.

KAPITEL V

ALLMÄNNA BESTÄMMELSER OM INFORMATION OCH

KLAGOMÅL

Artikel 24

Rätt till reseinformation

Transportörer och terminaloperatörer ska inom sina respektive behörighetsområden ge passagerarna adekvat information under

hela resan. Om det är möjligt ska informationen på begäran lämnas i en form som är tillgänglig för alla.

Artikel 25

Information om passagerarnas rättigheter

1.Transportörer och terminaloperatörer ska inom sina re­ spektive behörighetsområden se till att passagerarna senast vid avgång ges lämplig och begriplig information om sina rättighe­ ter enligt denna förordning. Denna information ska lämnas i terminalerna och, i förekommande fall, på Internet. På begäran av en person med funktionshinder eller nedsatt rörlighet ska informationen när så är möjligt lämnas i en form som är till­ gänglig för honom eller henne. Informationen ska innehålla kontaktuppgifter för tillsynsorganet eller -organen som med­ lemsstaten utsett i enlighet med artikel 28.1.

2.För att uppfylla det informationskrav som avses i punkt 1 får transportörer och terminaloperatörer använda den samman­ fattning av bestämmelserna i denna förordning som kommis­ sionen utarbetat på Europeiska unionens institutioners samtliga officiella språk och som ställts till deras förfogande.

Artikel 26

Klagomål

Transportörerna ska inrätta eller ha infört en mekanism för hantering av klagomål avseende de rättigheter och skyldigheter som avses i denna förordning.

Artikel 27

Inlämnande av klagomål

Utan att det påverkar rätten att framställa krav på ersättning i enlighet med artikel 7 ska en passagerare som omfattas av denna förordning och som vill lämna in ett klagomål till trans­ portören göra detta inom tre månader från den dag då linje­ trafiktjänsten utfördes eller när den borde ha utförts. Inom en månad efter det att klagomålet har mottagits ska transportören underrätta passageraren om huruvida hans eller hennes klago­ mål har accepterats, avslagits eller fortfarande behandlas. Tiden för att lämna det slutliga svaret får inte överstiga tre månader från mottagandet av klagomålet.

KAPITEL VI

EFTERLEVNAD OCH NATIONELLA TILLSYNSORGAN

Artikel 28

Nationella tillsynsorgan

1. Varje medlemsstat ska utse ett eller flera nya eller befint­ liga organ med ansvar för att denna förordning efterlevs när det gäller linjetrafik från platser inom det egna territoriet och linje­ trafik från ett tredjeland till sådana platser. Varje organ ska vidta de åtgärder som är nödvändiga för att säkerställa att denna förordning efterlevs.

L 55/10

SV

Europeiska unionens officiella tidning

28.2.2011

 

 

 

 

 

Varje organ ska, vad gäller organisation, beslut om finansiering, rättslig struktur och beslutsfattande, vara oberoende av trans­ portörer, researrangörer och terminaloperatörer.

2.Medlemsstaterna ska underrätta kommissionen om det eller de organ som de har utsett enligt denna artikel.

3.Varje passagerare får lämna klagomål i enlighet med na­ tionell lagstiftning till ett behörigt organ som har utsetts enligt punkt 1 eller till ett annat behörigt organ som en medlemsstat har utsett, när det gäller en påstådd överträdelse av denna för­ ordning.

En medlemsstat får besluta att passageraren som en första åt­ gärd ska lämna ett klagomål till transportören, i vilket fall det nationella tillsynsorganet eller ett annat behörigt organ som en medlemsstat har utsett ska utgöra överklagandeinstans för de klagomål som inte avgjorts enligt artikel 27.

Artikel 29

Rapport om kontroll av efterlevnad

Senast den 1 juni 2015 och därefter vartannat år ska de till­ synsorgan som har utsetts enligt artikel 28.1 offentliggöra en rapport om sin verksamhet under de två föregående kalenderå­ ren, med bland annat en beskrivning av de åtgärder som vid­ tagits för att genomföra denna förordning och statistiska upp­ gifter om klagomål och sanktioner som tillämpats.

Artikel 30

Samarbete mellan tillsynsorgan

De nationella tillsynsorgan som avses i artikel 28.1 ska i till­ lämpliga fall utbyta information om sitt arbete och sina be­ slutsprinciper och sin beslutspraxis. Kommissionen ska stödja dem i detta arbete.

Artikel 31

Sanktioner

Medlemsstaterna ska fastställa regler för sanktioner vid överträ­ delse av bestämmelserna i denna förordning och vidta alla nöd­

vändiga åtgärder för att se till att de följs. De fastställda sank­ tionerna ska vara effektiva, proportionella och avskräckande. Medlemsstaterna ska anmäla dessa regler och åtgärder till kom­ missionen senast den 1 mars 2013 och utan dröjsmål anmäla varje senare ändring av dem.

KAPITEL VII

SLUTBESTÄMMELSER

Artikel 32

Rapport

Senast den 2 mars 2016 ska kommissionen lämna en rapport till Europaparlamentet och rådet om hur förordningen tillämpas och om dess verkan. Denna rapport ska vid behov åtföljas av lagstiftningsförslag för mer detaljerat genomförande av bestäm­ melserna i denna förordning eller för ändring av förordningen.

Artikel 33

Ändring av förordning (EG) nr 2006/2004

I bilagan till förordning (EG) nr 2006/2004 ska följande punkt läggas till:

”19. Europaparlamentets och rådets förordning (EU) nr. 181/2011 av den 16 februari 2011 om passagerares rättigheter vid busstransport (*).

___________

(*) EUT L 55, 28.2.2011, s. 1.”

Artikel 34

Ikraftträdande

Denna förordning träder i kraft den tjugonde dagen efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Den ska tillämpas från och med den 1 mars 2013.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Strasbourg den 16 februari 2011.

 

På Europaparlamentets vägnar

På rådets vägnar

J. BUZEK

MARTONYI J.

Ordförande

Ordförande

 

 

 

28.2.2011

 

SV

Europeiska unionens officiella tidning

L 55/11

 

 

 

 

 

BILAGA I

ASSISTANS SOM SKA LÄMNAS TILL PERSONER MED FUNKTIONSHINDER OCH PERSONER MED

NEDSATT RÖRLIGHET

a)Assistans vid utsedda terminaler

Assistans och arrangemang som är nödvändiga för att möjliggöra för personer med funktionshinder och personer med nedsatt rörlighet att

anmäla sin ankomst till terminalen och begära assistans på angivna platser,

förflytta sig från den angivna platsen till incheckning, väntsal och påstigningsområde,

stiga på fordonet, med hjälp av hissar, rullstolar eller annan assistans som i förekommande fall kan behövas,

lasta sitt bagage,

hämta sitt bagage,

stiga av fordonet,

medföra en erkänd assistanshund ombord på bussen,

förflytta sig till sin sittplats.

b)Assistans ombord

Assistans och arrangemang som är nödvändiga för att möjliggöra för personer med funktionshinder och personer med nedsatt rörlighet att

få väsentlig information om resan i tillgänglig form, under förutsättning att passageraren begär detta,

stiga på och av fordonet vid uppehåll under resan, om annan personal än föraren finns ombord.

L 55/12

SV

Europeiska unionens officiella tidning

28.2.2011

 

 

 

 

 

BILAGA II

UTBILDNING OM FUNKTIONSHINDER

a)Utbildning om medvetenhet rörande funktionshinder

Utbildningen av personal som är i direkt kontakt med den resande allmänheten inbegriper följande:

Medvetenhet om och lämpligt bemötande av passagerare med fysiska eller sensoriska hinder (hörsel och syn), dolda svårigheter eller inlärningssvårigheter, inbegripet hur man skiljer mellan olika förmågor hos personer vars rörlighet eller orienterings- eller kommunikationsförmåga kan vara nedsatt.

De hinder som personer med funktionshinder och personer med nedsatt rörlighet stöter på, inbegripet attitydmäs­ siga, miljömässiga, fysiska och organisatoriska hinder.

Erkända assistanshundar, inbegripet en assistanshunds roll och behov.

Hantering av oförutsedda händelser.

Kunskap om mänskligt beteende och metoder för kommunikation med döva personer och personer med nedsatt hörsel, personer med nedsatt syn, personer med talsvårigheter och personer med inlärningssvårigheter.

Hantering av rullstolar och andra rörlighetshjälpmedel på ett varsamt sätt för att undvika skador (för alla delar av personalen med ansvar för bagagehantering om sådan förekommer).

b)Utbildning om assistans till personer med funktionshinder

Utbildning av personal som ger assistans till personer med nedsatt rörlighet inbegriper följande:

Hur man hjälper rullstolsanvändare att flytta sig till och ur en rullstol.

Hur man ger assistans till personer med funktionshinder eller nedsatt rörlighet som reser med en erkänd assis­ tanshund, inbegripet en sådan hunds roll och behov.

Tekniker för ledsagning av passagerare med nedsatt synförmåga och för hantering och transport av erkända assistanshundar.

Förståelse av de typer av utrustning som kan vara till hjälp för personer med funktionshinder och personer med nedsatt rörlighet och kunskap om hur sådan utrustning hanteras.

Användning av den utrustning för assistans vid påstigning och avstigning som ska användas och kunskap om de lämpliga assistansförfaranden vid påstigning och avstigning som är avsedda att trygga säkerheten och värdigheten för personer med funktionshinder och personer med nedsatt rörlighet.

Förståelse för behovet av tillförlitlig och professionell assistans. Även medvetenhet om att vissa passagerare med funktionshinder eller nedsatt rörlighet kan uppleva känslor av sårbarhet under resan eftersom de är beroende av den assistans som ges.

Kunskaper om första hjälpen.

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/3

 

 

 

 

EUROPAPARLAMENTETS OCH RÅDETS FÖRORDNING (EG) nr 1008/2008

av den 24 september 2008

om gemensamma regler för tillhandahållande av lufttrafik i gemenskapen (omarbetning)

(Text av betydelse för EES)

EUROPAPARLAMENTET OCH EUROPEISKA UNIONENS RÅD HAR ANTAGIT DENNA FÖRORDNING

med beaktande av fördraget om upprättandet av Europeiska gemenskapen, särskilt artikel 80.2,

med beaktande av kommissionens förslag,

med beaktande av Europeiska ekonomiska och sociala kom- mitténs yttrande (1),

med beaktande av Regionkommitténs yttrande (2),

i enlighet med förfarandet i artikel 251 i fördraget (3), och

av följande skäl:

(1)En rad väsentliga ändringar bör göras i rådets förordningar (EEG) nr 2407/92 av den 23 juli 1992 om utfärdande av tillstånd för lufttrafikföretag (4), (EEG) nr 2408/92 av den 23 juli 1992 om EG-lufttrafikföretags tillträde till flyglinjer inom gemenskapen (5) och (EEG) nr 2409/92 av den 23 juli 1992 om biljettpriser och fraktpriser för lufttrafik (6). Av tydlighetsskäl bör dessa förordningar omarbetas och konsolideras till en enda förordning.

(2)För att säkerställa en effektivare och enhetligare tillämpning av gemenskapens lagstiftning för den inre luftfartsmarkna- den krävs en rad justeringar av nuvarande regelverk.

(3)Med tanke på det potentiella sambandet mellan ett lufttrafikföretags finansiella ställning och säkerheten, bör en strängare övervakning av lufttrafikföretagens finansiella situation organiseras.

(4)Med tanke på att lufttrafikföretag med verksamhetsbaser i flera medlemsstater ökar i betydelse och med tanke på

(1) EUT C 175, 27.7.2007, s. 85. (2) EUT C 305, 15.12.2007, s. 11.

(3) Europaparlamentets yttrande av den 11 juli 2007 (EUT C 175 E, 10.7.2008, s. 371), rådets gemensamma ståndpunkt av den 18 april 2008 (EUT C 129 E, 27.5.2008, s. 1) och Europaparlamentets ståndpunkt av den 9 juli 2008 (ännu ej offentliggjord i EUT).

(4) EGT L 240, 24.8.1992, s. 1. (5) EGT L 240, 24.8.1992, s. 8. (6) EGT L 240, 24.8.1992, s. 15.

behovet av att säkerställa effektiv övervakning av dessa lufttrafikföretag, bör en och samma medlemsstat ha ansvaret för tillsyn av drifttillstånd och operativ licens.

(5)För att säkerställa enhetlig kontroll av att alla EG-luft- trafikföretag uppfyller kraven i de operativa licenserna, bör tillståndsmyndigheterna genomföra regelbundna utvärder- ingar av lufttrafikföretagens finansiella situation. Därför bör de sistnämnda tillhandahålla tillräckliga upplysningar om sin finansiella situation, i synnerhet under de första två åren av sin verksamhet eftersom denna period är särskilt kritisk för ett lufttrafikföretags överlevnad på marknaden. För att undvika en snedvridning av konkurrensen orsakad av att reglerna tillämpas olika på nationell nivå är det nödvändigt att stärka medlemsstaternas finansiella tillsyn av alla EG- lufttrafikföretag.

(6)För att minska risken för passagerarna bör EG-lufttrafik- företag som inte uppfyller kraven för upprätthållande av en giltig operativ licens inte tillåtas att fortsätta sin verksamhet. I sådana fall bör den behöriga tillståndsmyndigheten permanent eller tillfälligt återkalla den operativa licensen.

(7) Enligt Europaparlamentets och rådets förordning (EG) nr 785/2004 av den 21 april 2004 om försäkringskrav för lufttrafikföretag och luftfartsoperatörer (7) bör ett lufttrafikföretag ha försäkringar som täcker dess skade- ståndsansvar i samband med olyckor avseende passagerare, gods och tredje man. Lufttrafikföretagen bör också vara skyldiga att ha försäkringar som täcker skadeståndsansvar i samband med olyckor avseende post.

(8)För att undvika överdriven användning av avtal om leasing av luftfartyg som är registrerade i tredjeländer, särskilt leasing med besättning (wet lease), bör detta medges endast under extraordinära förhållanden, t.ex. om det råder brist på erforderliga luftfartyg på gemenskapsmarknaden, och tillstånden bör därvid vara strikt tidsbegränsade och uppfylla säkerhetsnormer som är likvärdiga med säkerhets- reglerna i gemenskapsrätten och nationell lagstiftning.

(9)När det gäller anställda hos ett EG-lufttrafikföretag som tillhandahåller luftfartstjänster från en operationell bas utanför territoriet i den medlemsstat där EG-lufttrafikföre-

(7) EUT L 138, 30.4.2004, s. 1.

L 293/4

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

taget har sin huvudsakliga verksamhet, bör medlemssta- terna se till att gemenskapens sociallagstiftning och nationell sociallagstiftning tillämpas på ett korrekt sätt.

(10)I syfte att förverkliga den inre luftfartsmarknaden bör man upphäva de restriktioner som ännu tillämpas mellan medlemsstaterna, t.ex. i fråga om överenskommelser om gemensamma linjebeteckningar (code sharing) på flyglinjer till tredjeländer eller i fråga om prissättning på flyglinjer till tredjeländer med mellanlandning i en annan medlemsstat (sjätte friheten).

(11)För att ta hänsyn till de yttersta randområdenas särdrag och särskilda begränsningar, särskilt deras avlägsna belägenhet, ökaraktär och ringa storlek, och behovet av att på lämpligt sätt förbinda dem med gemenskapens centrala områden, kan en särskild ordning vara motiverad när det gäller reglerna om giltighetstiden för avtal om allmän trafikplikt på flyglinjer till sådana regioner.

(12)De förhållanden under vilka allmän trafikplikt får införas bör tydligt fastställas på ett otvetydigt sätt, samtidigt som därmed sammanhörande anbudsförfaranden bör möjlig- göra för ett tillräckligt antal konkurrerande lufttrafikföretag att delta i förfarandena. Kommissionen bör kunna inhämta all information som är nödvändig för att kunna bedöma de ekonomiska motiven för allmän trafikplikt i enskilda fall.

(13)Gällande regler för fördelning av trafik mellan flygplatser som betjänar samma stad eller tätortsområde bör klargöras och förenklas.

(14)Medlemsstaterna bör kunna ha möjlighet att reagera på plötsligt uppkomna problem förorsakade av oförutsebara och oundvikliga omständigheter som gör det tekniskt eller praktiskt mycket svårt att utöva lufttrafik.

(15)Kunderna bör ha tillgång till samtliga passagerarpriser och fraktpriser oavsett bosättningsort inom gemenskapen eller nationalitet och oberoende av researrangörernas etable- ringsort inom gemenskapen.

(16)Kunderna bör kunna effektivt göra jämförelser av priserna för lufttrafik hos olika flygbolag. Därför bör det slutliga priset som kunden ska betala för lufttrafik med ursprung i gemenskapen alltid anges inklusive alla skatter och avgifter. EG-lufttrafikföretag uppmanas också att ange det slutliga priset för sina luftfartstjänster från tredjeländer till gemenskapen.

(17)De åtgärder som är nödvändiga för att genomföra denna förordning bör antas i enlighet med rådets beslut 1999/ 468/EG av den 28 juni 1999 om de förfaranden som skall

tillämpas vid utövandet av kommissionens genomförande- befogenheter (1).

(18)Eftersom målet för denna förordning, nämligen en enhetligare tillämpning av gemenskapslagstiftningen med avseende på den inre luftfartsmarknaden inte i tillräcklig utsträckning kan uppnås av medlemsstaterna på grund av luftfartens internationella karaktär, och det därför bättre kan uppnås på gemenskapsnivå, kan gemenskapen vidta åtgärder i enlighet med subsidiaritetsprincipen i artikel 5 i fördraget. I enlighet med proportionalitetsprincipen i samma artikel går denna förordning inte utöver vad som är nödvändigt för att uppnå det målet.

(19)Ministeruttalandet om Gibraltars flygplats, som man enades om i Córdoba den 18 september 2006 under det första ministermötet i forumet för dialog om Gibraltar, kommer att ersätta den gemensamma förklaring om Gibraltars flygplats som gjordes i London den 2 december 1987, och full överensstämmelse med det uttalandet kommer att betraktas som överensstämmelse med förklaringen från 1987.

(20)Det är därför nödvändigt att upphäva förordningarna (EEG) nr 2407/92, (EEG) nr 2408/92 och (EEG) nr 2409/92.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

KAPITEL I

ALLMÄNNA BESTÄMMELSER

Artikel 1

Syfte

1.Genom denna förordning regleras utfärdandet av tillstånd för EG-lufttrafikföretag, deras rätt att utöva lufttrafik inom gemenskapen samt prissättningen av lufttrafik inom gemen- skapen.

2.Tillämpningen av kapitel III i denna förordning på flygplatsen i Gibraltar påverkar inte Konungariket Spaniens och Förenade kungarikets rättsliga ställning med avseende på tvisten om överhöghet över det territorium där flygplatsen är belägen.

Artikel 2

Definitioner

I denna förordning avses med

1.operativ licens: ett tillstånd, utfärdat av den behöriga

tillståndsmyndigheten för ett

företag, att tillhandahålla

den lufttrafik som anges i den

operativa licensen,

(1) EGT L 184, 17.7.1999, s. 23.

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/5

 

 

 

 

2.behörig tillståndsmyndighet: en medlemsstats myndighet som har rätt att bevilja eller avslå en ansökan om operativ licens, eller att permanent eller tillfälligt återkalla en operativ licens, i enlighet med kapitel II,

3.företag: en fysisk eller juridisk person, oavsett om verksam- heten bedrivs i vinstsyfte eller ej, eller ett officiellt organ, oavsett om det har självständig status som juridisk person eller ej,

4.lufttrafik: en flygning eller en serie flygningar för befordran av passagerare, gods och/eller post mot ersättning och/eller hyra,

5.flygning: en avgång från en angiven flygplats till en angiven destinationsflygplats,

6.lokal flygning: en flygning som inte innebär befordran av passagerare, post och/eller frakt mellan olika flygplatser eller andra godkända landningspunkter,

7.flygplats: ett område i en medlemsstat som är särskilt anpassat för lufttrafik,

8.drifttillstånd (AOC): ett tillstånd, utfärdat i enlighet med relevanta bestämmelser i gemenskapslagstiftningen eller nationell lagstiftning, i tillämpliga fall, för ett företag, i vilket intygas att företaget har de yrkesmässiga kunskaper och den organisation som krävs för att på ett betryggande sätt sköta den verksamhet som anges i tillståndet,

9.effektiv kontroll: ett förhållande som bygger på rättigheter, avtal eller annat, som var för sig eller tillsammans och med hänsyn till faktiska och rättsliga förhållanden, ger möjlig- heter att direkt eller indirekt utöva ett avgörande inflytande på ett företag, särskilt genom

a)rätten att använda alla eller delar av ett företags tillgångar,

b)rättigheter eller avtal som ger ett avgörande inflytande på sammansättningen av företagets olika organ, omröstningar eller beslut, eller som på annat sätt ger ett avgörande inflytande på företagets verksamhet,

10.lufttrafikföretag: ett företag med en giltig operativ licens eller motsvarande,

11.EG-lufttrafikföretag: ett lufttrafikföretag med giltig operativ licens som utfärdats av en behörig tillståndsmyndighet i enlighet med kapitel II,

12.verksamhetsplan: en detaljerad beskrivning av lufttrafikföre- tagets planerade affärsverksamhet under den aktuella perioden, särskilt med avseende på förväntad marknadsut- veckling och planerade investeringar, samt de finansiella och ekonomiska följderna av denna verksamhet,

13.lufttrafik inom gemenskapen: lufttrafik som utförs inom gemenskapen,

14.trafikrättighet: rättighet att utöva lufttrafik mellan två flygplatser inom gemenskapen,

15.seat only-försäljning: ett lufttrafikföretags, en av dess godkända agenters eller en researrangörs försäljning av platser direkt till allmänheten utan att några andra tjänster, såsom logi, ingår,

16.regelbunden lufttrafik: en serie flygningar där varje flygning uppfyller kriterierna

a)att det på varje flygning finns platser och/eller kapacitet att transportera gods och/eller post som allmänheten kan köpa på individuell basis (antingen direkt av lufttrafikföretaget eller av godkända agenter),

b)den bedrivs så att den betjänar trafiken mellan samma flygplatser, två eller flera, antingen

enligt en offentliggjord tidtabell, eller

med flygningar som är så regelbundna eller täta att de utgör en tydlig och planmässig serie,

17.kapacitet: det antal platser eller den nyttolast som erbjuds allmänheten i regelbunden luftfart under en given period,

18.passagerarpriser: de priser i euro eller i nationell valuta som ska betalas till lufttrafikföretag eller dessas agenter, eller andra biljettförsäljare, för befordran av passagerare i lufttrafik samt de villkor som hänför sig till dessa priser, inbegripet ersättning och villkor som erbjuds agenter och andra mellanhänder,

19.fraktpriser: de priser i euro eller i nationell valuta som ska betalas för fraktbefordran samt de villkor som hänför sig till dessa priser, inbegripet ersättning och villkor som erbjuds agenter och andra mellanhänder,

20.berörda medlemsstater: den eller de medlemsstater som lufttrafiken bedrivs mellan eller inom,

L 293/6

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

21.involverade medlemsstater: den eller de berörda medlemsstater och den eller de medlemsstater där de lufttrafikföretag som bedriver lufttrafik har tillstånd,

22.tätortsområde: ett stadsområde som omfattar ett antal olika städer som, till följd av befolkningstillväxt och expansion, har växt ihop så att de bildar ett sammanhängande bebyggt område,

23.driftredovisning: en detaljerad redogörelse för ett lufttrafik- företags intäkter och kostnader under den aktuella perioden, fördelad på lufttransportverksamhet och annan verksamhet, och på materiella och immateriella poster,

24.avtal om leasing utan besättning (dry lease): ett avtal mellan företag enligt vilket luftfartyget brukas i enlighet med inhyrarens drifttillstånd,

25.avtal om leasing med besättning (wet lease): ett avtal mellan lufttrafikföretag enligt vilket luftfartyget brukas i enlighet med uthyrarens drifttillstånd,

26.huvudsaklig verksamhet: ett EG-lufttrafiksföretags huvudkon- tor eller säte i den medlemsstat i vilken EG-lufttrafiksföre- tagets huvudsakliga finansiella funktioner och operativa ledning utövas, inbegripet styrning av fortsatt luftvärdighet.

KAPITEL II

OPERATIV LICENS

Artikel 3

Operativ licens

1. Inget företag som är etablerat i gemenskapen får mot ersättning och/eller hyra utföra lufttransporter av passagerare, post och/eller gods om det inte har beviljats den nödvändiga operativa licensen.

Ett företag som uppfyller kraven i detta kapitel har rätt att få en operativ licens utfärdad.

2.Den behöriga tillståndsmyndigheten får inte utfärda ope- rativa licenser eller upprätthålla deras giltighet om inte kraven i detta kapitel uppfylls.

3.Utan att det påverkar tillämpningen av andra gällande bestämmelser i gemenskapsrätten, nationell rätt eller inter- nationell rätt ska följande kategorier av lufttrafik undantas från kravet på innehav av giltiga operativa licenser:

a)Lufttrafik som utförs med icke-motordrivna luftfartyg och/ eller ultralätta motordrivna luftfartyg.

b)Lokala flygningar.

Artikel 4

Villkor för beviljande av operativa licenser

Den behöriga tillståndsmyndigheten i en medlemsstat ska bevilja operativ licens för ett företag om följande villkor är uppfyllda:

a)Företagets huvudsakliga verksamhet bedrivs i denna medlemsstat.

b)Företaget har ett drifttillstånd utfärdat av en nationell myndighet i samma medlemsstat vars behöriga tillstånds- myndighet har ansvaret för att utfärda, vägra eller tillfälligt eller permanent återkalla EG-lufttrafikföretagets drifttill- stånd.

c)Företaget förfogar över ett eller flera luftfartyg, antingen som ägare eller genom ett avtal om leasing utan besättning (dry lease).

d)Företagets huvudsakliga verksamhet är att bedriva lufttrafik enbart eller i kombination med annat affärsmässigt utnyttjande av luftfartyg eller reparation och underhåll av dem.

e)Företagets struktur gör det möjligt för den behöriga tillståndsmyndigheten att genomföra bestämmelserna i detta kapitel.

f)Medlemsstater och/eller medborgare i medlemsstater äger mer än 50 % av företaget och utövar den faktiska kontrollen över detta, antingen direkt eller indirekt via ett eller flera andra företag, om inte annat föreskrivs i ett avtal med ett tredjeland i vilket gemenskapen är part.

g)Företaget uppfyller de finansiella villkor som anges i artikel 5.

h)Företaget uppfyller de försäkringskrav som anges i artikel 11 och i förordning (EG) nr 785/2004.

i)Företaget uppfyller bestämmelserna om gott anseende enligt artikel 7.

Artikel 5

Finansiella villkor för beviljande av operativa licenser

1. Den behöriga tillståndsmyndigheten ska ingående bedöma huruvida ett företag som för första gången ansöker om operativ licens kan visa

a)att det när som helst kan uppfylla sina faktiska och potentiella åtaganden baserade på realistiska antaganden, under 24 månader räknat från driftstarten, och

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/7

 

 

 

 

b)att det kan täcka de fasta och rörliga kostnader som följer av verksamhetsplanen och som baseras på realistiska anta- ganden utan beaktande av driftintäkter, under tre månader från driftstarten.

2.För den bedömning som avses i punkt 1 ska varje sökande lämna en verksamhetsplan för minst de första tre driftåren. Verksamhetsplanen ska också ge en detaljerad redogörelse för sökandens ekonomiska förbindelser med andra affärsmässiga verksamheter som sökanden medverkar i, direkt eller via besläktade företag. Sökanden ska också lämna alla relevanta uppgifter, särskilt sådana som anges under punkt 1 i bilaga I.

3.Punkterna 1 och 2 ska inte tillämpas på ett företag som ansöker om en operativ licens som är avsedd att omfatta verksamhet med luftfartyg vars högsta godkända startmassa (MTOM) är mindre än 10 ton och/eller som har färre än 20 säten. Sådana företag ska kunna visa att deras nettokapital är minst 100 000 EUR eller på begäran från den behöriga tillståndsmyndigheten lämna all relevant information för den bedömning som avses i punkt 1, särskilt de uppgifter som avses i punkt 1 i bilaga I.

Den behöriga tillståndsmyndigheten får dock tillämpa punkterna 1 och 2 på ett företag som ansöker om en operativ licens, enligt bestämmelserna i föregående stycke, och som tänker bedriva regelbunden lufttrafik eller vars årliga omsättning överstiger 3 000 000 EUR.

Artikel 6

Drifttillstånd (AOC)

1.Det ska alltid vara ett villkor för utfärdandet av operativ licens och för dess giltighet att det berörda företaget har ett gällande drifttillstånd med angivande av den verksamhet den operativa licensen omfattar.

2.Varje ändring i ett EG-lufttrafikföretags drifttillstånd ska när så är lämpligt avspeglas i dess operativa licens.

Artikel 7

Styrkande av gott anseende

1. Om det för utfärdande av en operativ licens krävs bevis på att de personer som fortlöpande och faktiskt kommer att stå för driften av företaget har gott anseende eller att de inte har gått i konkurs, ska den behöriga tillståndsmyndigheten när det gäller medborgare från medlemsstater som tillräcklig bevisning godkänna sådana handlingar som utfärdats av behöriga myndig- heter i ursprungsmedlemsstaten eller den medlemsstat där

personen har sin hemvist, och där det framgår att dessa krav är uppfyllda.

2.Om ursprungsmedlemsstaten eller den medlemsstat där personen har sin hemvist inte utfärdar de handlingar som avses i punkt 1, ska dessa ersättas av en förklaring under ed eller, i medlemsstater där inga bestämmelser om edgång finns, av en högtidlig förklaring av den berörda personen inför en behörig rättslig eller administrativ myndighet eller i förekommande fall inför en särskild tjänsteman eller en behörig yrkesorganisation i ursprungsmedlemsstaten eller den medlemsstat där personen har sin hemvist. Myndigheten, den särskilda tjänstemannen eller den behöriga yrkesorganisationen ska utfärda ett intyg som bekräf- telse på denna ed eller högtidliga förklaring.

3.Den behöriga tillståndsmyndigheten får kräva att de hand- lingar och intyg som anges i punkterna 1 och 2 visas upp senast tre månader efter utfärdandet.

Artikel 8

Giltigheten för en operativ licens

1. En operativ licens ska vara giltig så länge ett EG-lufttrafik- företag uppfyller kraven i detta kapitel.

Ett EG-lufttrafikföretag ska när som helst på anmodan kunna visa den behöriga tillståndsmyndigheten att det uppfyller samtliga krav i detta kapitel.

2. Den behöriga tillståndsmyndigheten ska noggrant övervaka efterlevnaden av kraven i detta kapitel. Den ska i alla händelser se över efterlevnaden av dessa krav i följande fall:

a)Två år efter det att en ny operativ licens har beviljats.

b)Vid misstanke om att ett problem kan ha uppstått.

c)På begäran av kommissionen.

Om den behöriga tillståndsmyndigheten misstänker att finansi- ella problem hos ett EG-lufttrafikföretag kan påverka säkerheten i dess verksamhet, ska den omedelbart informera den myndighet som har ansvaret för drifttillståndet.

3. Den operativa licensen ska omprövas för godkännande när ett EG-lufttrafikföretag

a)inte har påbörjat verksamheten inom sex månader efter det att den operativa licensen beviljades,

b)har inställt driften i mer än sex månader,

L 293/8

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

c)som beviljats tillstånd på grundval av artikel 5.3 första stycket avser att bedriva verksamhet med luftfartyg över den lägsta storlek som anges i artikel 5.3 eller inte längre uppfyller de finansiella kraven i den punkten.

4. Ett EG-lufttrafikföretag ska till den behöriga tillstånds- myndigheten lämna in sina reviderade räkenskaper senast sex månader efter den sista dagen i respektive räkenskapsår, såvida inte annat föreskrivs i nationell lagstiftning. Under ett EG-lufttrafikföretags första två verksamhetsår ska de uppgifter som anges i punkt 3 i bilaga I på begäran ställas till den behöriga tillståndsmyndighetens förfogande.

Den behöriga tillståndsmyndigheten får när som helst genom- föra en utvärdering av de ekonomiska resultaten för ett EG-lufttrafikföretag som den har beviljat en operativ licens genom att begära att få tillgång till relevant information. Som ett led i denna utvärdering ska EG-lufttrafikföretaget uppdatera de uppgifter som anges i punkt 3 i bilaga I och på begäran lämna dessa till den behöriga tillståndsmyndigheten.

5. Ett EG-lufttrafikföretag ska till den behöriga tillstånds- myndigheten

a)i förväg anmäla planer på att starta ny lufttrafik till en kontinent eller del av världen som det tidigare inte flugit på, eller andra betydande förändringar i fråga om verksam- hetens omfattning, inbegripet men inte begränsat till ändringar av typen av eller antalet använda luftfartyg,

b)i förväg anmäla planerade fusioner eller nyförvärv, och

c)inom 14 dagar anmäla ägarskifte av aktieposter som utgör 10 % eller mer av det samlade aktieinnehavet i EG-lufttrafikföretaget, dess moderföretag eller slutliga holdingbolag.

6. Om den behöriga tillståndsmyndigheten bedömer att de förändringar som anmälts enligt punkt 5 har väsentlig inverkan på EG-lufttrafikföretagets finanser, ska myndigheten begära in en reviderad verksamhetsplan som innehåller de aktuella föränd- ringarna och som omfattar minst en period på 12 månader från den dag då den börjar genomföras, samt de uppgifter som anges under punkt 2 i bilaga I, utöver den information som ska tillhandahållas enligt punkt 4.

Den behöriga tillståndsmyndigheten ska fatta ett beslut om den reviderade verksamhetsplanen med avseende på huruvida EG-lufttrafikföretaget kan fullgöra sina faktiska och potentiella förpliktelser under denna tolvmånadersperiod. Beslutet ska fattas

senast tre månader efter det att all nödvändig information har lämnats in.

7.När det gäller EG-lufttrafikföretag som den behöriga tillståndsmyndigheten utfärdat licens för, ska den senare besluta om den operativa licensen ska omprövas för godkännande om förändringar har inträffat i en eller flera förutsättningar som berör ett EG-lufttrafikföretags rättsliga ställning, i synnerhet en fusion eller ett övertagande.

8.Punkterna 4, 5 och 6 gäller inte för EG-lufttrafikföretag som enbart bedriver verksamhet med luftfartyg vars högsta tillåtna startmassa (MTOM) är mindre än 10 ton och/eller som har färre än 20 säten. Sådana EG-lufttrafikföretag ska när som helst kunna visa att deras nettokapital är minst 100 000 EUR eller på begäran från den behöriga tillståndsmyndigheten lämna den information som behövs för den utvärdering som avses i artikel 9.2.

Den behöriga tillståndsmyndigheten får dock tillämpa punkterna 4, 5 och 6 på EG-lufttrafikföretag som den har utfärdat tillstånd för och som bedriver regelbunden lufttrafik eller vars årliga omsättning överstiger 3 000 000 EUR.

Artikel 9

Tillfälligt och permanent återkallande av operativa licenser

1.Den behöriga tillståndsmyndigheten får alltid utvärdera det ekonomiska resultat för ett EG-lufttrafikföretag som den beviljat licens. På grundval av sin bedömning ska myndigheten tillfälligt eller permanent återkalla den operativa licensen om den inte längre bedömer det som säkert att detta EG-lufttrafikföretag kan uppfylla sina faktiska och potentiella åtaganden för en tolvmånadersperiod. Den behöriga tillståndsmyndigheten får trots detta bevilja en tillfällig licens, med högst tolv månaders giltighetstid, i avvaktan på en ekonomisk omorganisation av ett EG-lufttrafikföretag, förutsatt att säkerheten inte äventyras, alla ändringar i drifttillståndet när så är lämpligt avspeglas i denna tillfälliga licens och att det finns en realistisk förhoppning om en tillfredsställande finansiell omorganisation inom denna tids- period.

2.Om det finns tydliga tecken på finansiella problem eller om ett insolvensförfarande eller liknande förfarande har inletts mot ett EG-lufttrafikföretag som den behöriga tillståndsmyndigheten har beviljat licens, ska denna utan dröjsmål göra en grundlig utvärdering av den finansiella situationen och på grundval av sina slutsatser inom tre månader ompröva den operativa licensens status i överensstämmelse med den här artikeln.

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/9

 

 

 

 

Den behöriga tillståndsmyndigheten ska informera kommissio- nen om sina beslut om den operativa licensens status.

3. Om de reviderade räkenskaper som anges i artikel 8.4 inte har lämnats in inom den tidsfrist som anges i den artikeln, ska den behöriga tillståndsmyndigheten utan oskäligt dröjsmål anmoda EG-lufttrafikföretaget att lämna in dessa reviderade räkenskaper.

Om de reviderade räkenskaperna inte har lämnats in inom en månad får den operativa licensen återkallas permanent eller tillfälligt.

4.Den behöriga tillståndsmyndigheten ska permanent eller tillfälligt återkalla den operativa licensen om EG-lufttrafikföre- taget uppsåtligen eller genom försumlighet förser den behöriga tillståndsmyndigheten med information som är felaktig i sak.

5.Om ett EG-lufttrafikföretags drifttillstånd återkallas tillfälligt eller permanent, ska den behöriga tillståndsmyndigheten ome- delbart återkalla, tillfälligt eller permanent, lufttrafikföretagets operativa licens.

6.Den behöriga tillståndsmyndigheten får permanent eller tillfälligt återkalla ett EG-lufttrafikföretags operativa licens om företaget inte längre uppfyller kraven på gott anseende enligt artikel 7.

Artikel 10

Beslut om operativa licenser

1.Den behöriga tillståndsmyndigheten ska fatta beslut i fråga om en ansökan så snart som möjligt och senast tre månader efter det att all nödvändig information har lämnats in, och därvid ta hänsyn till alla tillgängliga fakta. Sökanden ska underrättas om beslutet. Ett avslag ska motiveras.

2.Tillvägagångssättet för beviljandet och för tillfälligt eller permanent återkallande av operativa licenser ska offentliggöras av de behöriga tillståndsmyndigheterna som ska underrätta kommissionen om detta.

3.En förteckning över de behöriga tillståndsmyndigheternas beslut att bevilja eller att tillfälligt eller permanent återkalla operativa licenser ska offentliggöras årligen i Europeiska unionens officiella tidning.

Artikel 11

Försäkringskrav

Utan hinder av förordning (EG) nr 785/2004 ska lufttrafikföretag vara försäkrade för att täcka ersättningsansvar i samband med olyckor med avseende på post.

Artikel 12

Registrering

1.Utan att det påverkar tillämpningen av artikel 13.3 ska luftfartyg som används av ett EG-lufttrafikföretag antingen registreras i det nationella registret i den medlemsstat vars behöriga myndighet ska utfärda den operativa licensen eller inom gemenskapen, beroende på vad den medlemsstaten föredrar.

2.I enlighet med punkt 1 ska den behöriga myndigheten utan dröjsmål och utan diskriminerande avgifter bevilja införande i sitt nationella register av luftfartyg som ägs av medborgare i andra medlemsstater, samt överföringar från andra medlems- staters register enligt gällande lagar och andra författningar. Vid överföring av luftfartyg ska ingen annan avgift tas ut utöver vanlig registreringsavgift.

Artikel 13

Leasing

1.Utan att det påverkar tillämpningen av artikel 4 c får ett EG-lufttrafikföretag förfoga över ett eller flera luftfartyg genom avtal om leasing med besättning (wet lease) eller om leasing utan besättning (dry lease). EG-lufttrafikföretag får fritt bedriva trafik med luftfartyg som är registrerade inom gemenskapen och som leasats med besättning utom när detta skulle leda till att säkerheten åsidosätts. Kommissionen ska se till att genom- förandet av en sådan bestämmelse blir rimlig och proportionell samt grundar sig på säkerhetshänsyn.

2.Ett avtal om leasing utan besättning (dry lease) i vilket ett EG-lufttrafikföretag är part, eller ett avtal om leasing med besättning (wet lease) i vilket EG-lufttrafikföretaget är inhyrare, ska förhandsgodkännas i enlighet med tillämplig gemenskaps- lagstiftning eller nationell lagstiftning om flygsäkerhet.

3.Ett EG-lufttrafikföretag som från ett annat företag leasar luftfartyg med besättning (wet lease) registrerat i ett tredjeland ska ansöka om förhandsgodkännande för inhyrningen från den behöriga tillståndsmyndigheten. Den behöriga myndigheten får lämna sitt godkännande om

a)EG-lufttrafikföretaget visar på ett för den behöriga myndig- heten tillfredsställande sätt att alla säkerhetsstandarder motsvarar vad som anges i gemenskapslagstiftningen eller den nationella lagstiftningen, och

b)ett av följande villkor uppfylls:

i)EG-lufttrafikföretaget motiverar denna leasing med behov av undantagskaraktär, varvid ett godkännande får beviljas för en tid av högst sju månader som får förlängas en gång med ytterligare en tid av högst sju månader.

L 293/10

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

ii)EG-lufttrafikföretaget visar att leasingen är nödvändig för att tillgodose säsongsrelaterade kapacitetsbehov som inte i tillräcklig utsträckning kan tillgodoses genom att leasa luftfartyg som är registrerade inom gemenskapen, i vilket fall godkännandet får förlängas.

iii)EG-lufttrafikföretaget visar att leasingen är nödvändig för att lösa driftsstörningar och att det inte är möjligt eller rimligt att leasa luftfartyg som är registrerade inom gemenskapen, i vilket fall godkännandet ska tidsbegränsas i enlighet med vad som är absolut nödvändigt för att lösa problemen.

4. Den behöriga myndigheten får knyta villkor till godkännan- det. Dessa villkor ska utgöra en del av avtalet om leasing med besättning (wet lease).

Den behöriga myndigheten får vägra att lämna godkännande i avsaknad av ömsesidighet när det gäller leasing av luftfartyg med besättning (wet lease) mellan å ena sidan den berörda medlems- staten eller gemenskapen och å andra sidan det tredjeland där det med besättning leasade luftfartyget (wet lease) är registrerat.

Den behöriga myndigheten ska underrätta de berörda medlems- staterna om godkännanden som den lämnar för leasing av sådana luftfartyg med besättning (wet lease) som är registrerade i ett tredjeland.

Artikel 14

Rätt att höras

Vid antagandet av ett beslut om tillfälligt eller permanent återkallande av ett EG-lufttrafikföretags operativa licens ska den behöriga tillståndsmyndigheten se till att det berörda företaget får tillfälle att höras, med beaktande av behovet av ett skyndsamt förfarande i vissa fall.

KAPITEL III

TILLTRÄDE TILL FLYGLINJER

Artikel 15

Tillhandahållande av lufttrafik inom gemenskapen

1.EG-lufttrafikföretag ska ha rätt att bedriva lufttrafik inom gemenskapen.

2.Medlemsstaterna får inte kräva någon form av tillstånd eller godkännande för ett EG-trafikföretags utövande av luft- trafik inom gemenskapen. Medlemsstaterna får inte kräva att EG- lufttrafikföretag tillhandahåller handlingar eller information som de redan har lämnat till den behöriga tillståndsmyndigheten, förutsatt att den berörda informationen kan erhållas från den behöriga tillståndsmyndigheten inom rimlig tid.

3. Om kommissionen på grundval av information som erhållits enligt artikel 26.2 finner att en operativ licens som beviljats ett EG-lufttrafikföretag inte uppfyller kraven i denna förordning, ska den överlämna sina slutsatser till den behöriga tillståndsmyndig- heten som inom 15 arbetsdagar ska lämna sina synpunkter till kommissionen.

Om kommissionen efter att ha granskat den behöriga tillstånds- myndighetens synpunkter vidhåller att den operativa licensen inte uppfyller kraven, eller om den inte har tagit emot några synpunkter från den behöriga tillståndsmyndigheten, ska den i enlighet med det förfarande som avses i artikel 25.2 besluta att begära att den behöriga tillståndsmyndigheten vidtar lämpliga korrigeringsåtgärder eller permanent eller tillfälligt återkallar den operativa licensen.

I beslutet ska ett datum fastställas då den behöriga tillstånds- myndigheten senast ska vidta korrigeringsåtgärderna. Om korri- geringsåtgärderna inte har vidtagits senast detta datum ska EG-lufttrafikföretaget inte ha rätt att utöva sina rättigheter enligt punkt 1.

EG-lufttrafikföretaget får på nytt börja utöva sina rättigheter enligt punkt 1 när den behöriga tillståndsmyndigheten till kommissionen anmält att korrigeringsåtgärderna har vidtagits och den behöriga tillståndsmyndigheten har kontrollerat att de vidtagits.

4. Vid utövande av lufttrafik inom gemenskapen ska ett EG-lufttrafikföretag tillåtas att kombinera lufttrafiken och att ingå överenskommelser om gemensamma linjebeteckningar (code share), utan att det påverkar tillämpningen av gemenskapens konkurrensregler som är tillämpliga på företag.

Alla begränsningar av EG-lufttrafikföretags frihet att bedriva lufttrafik inom gemenskapen, vilka härrör från bilaterala avtal mellan medlemsstater, upphävs härmed.

5. Utan hinder av bestämmelserna i bilaterala avtal mellan medlemsstater, och om inte annat föreskrivs i gemenskapens konkurrensregler som är tillämpliga på företag, ska berörda medlemsstater ge EG-lufttrafikföretag tillstånd att kombinera lufttrafik och att ingå överenskommelser om gemensamma linjebeteckningar (code share) med valfritt lufttrafikföretag för lufttrafik till, från eller via alla flygplatser på deras territorium från eller till alla punkter i tredjeländer.

En medlemsstat får inom ramen för ett bilateralt lufttrafikavtal med det berörda tredjelandet införa restriktioner mot överens- kommelser om gemensamma linjebeteckningar (code share) mellan EG-lufttrafikföretag och lufttrafikföretag från tredjeland, i synnerhet om det berörda tredjelandet inte tillåter liknande kommersiella möjligheter för de EG-lufttrafikföretag som bedriver trafik från den berörda medlemsstaten. Medlemsstaterna

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/11

 

 

 

 

ska därvid se till att de restriktioner som införs genom sådana överenskommelser inte begränsar konkurrensen och inte diskriminerar mellan EG-lufttrafikföretag och att de inte är mer restriktiva än nödvändigt.

Artikel 16

Allmänna principer för allmän trafikplikt

1. En medlemsstat får, efter samråd med andra berörda medlemsstater och efter att ha meddelat kommissionen, berörda flygplatser och de lufttrafikföretag som utövar lufttrafik på flyglinjen, inom sitt territorium införa allmän trafikplikt med avseende på regelbunden lufttrafik mellan en flygplats i gemenskapen och en flygplats som betjänar ett ytterområde eller ett utvecklingsområde på dess territorium eller på en flyglinje med låg trafikintensitet till valfri flygplats på dess territorium, om flyglinjen anses väsentlig för den ekonomiska och sociala utvecklingen i den region som flygplatsen betjänar. Trafikplikten ska införas endast i den utsträckning som är nödvändig för att på denna flyglinje säkerställa ett minimiutbud av regelbunden lufttrafik som uppfyller fastställda normer för kontinuitet, regelbundenhet, prissättning eller minimikapacitet, vilka lufttrafikföretagen inte skulle uppfylla om de enbart tog hänsyn till sina kommersiella intressen.

Normerna för den flyglinje som omfattas av den allmänna trafikplikten ska fastställas på ett öppet och icke-diskriminerande sätt.

2.I de fall då inget annat transportsätt kan säkerställa en oavbruten trafik med minst två dagliga avgångar, får de berörda medlemsstaterna även låta den allmänna trafikplikten omfatta ett krav på att alla EG-lufttrafikföretag som avser att utöva lufttrafik på flyglinjen garanterar att de kommer att göra detta under en viss period som ska fastställas i enlighet med de andra villkoren för allmän trafikplikt.

3.Frågan om huruvida en planerad allmän trafikplikt är nödvändig och adekvat ska bedömas av medlemsstaterna med beaktande av

a)proportionaliteten mellan den planerade trafikplikten och den berörda regionens behov av ekonomisk utveckling,

b)möjligheten att anlita andra transportsätt samt dessas ändamålsenlighet när det gäller att tillgodose de aktuella transportbehoven, i synnerhet när befintliga tågförbindelser betjänar den planerade sträckan med en restid på mindre än tre timmar och med tillräcklig frekvens, tillräckliga förbindelser och lämpliga tidpunkter,

c)de passagerarpriser och villkor som kan erbjudas kunderna,

d)det samlade resultatet av insatserna från alla lufttrafikföre- tag som utövar eller avser att utöva lufttrafik på flyglinjen.

4. När en medlemsstat vill införa allmän trafikplikt ska den överlämna texten om det planerade införandet av den allmänna trafikplikten till kommissionen, till övriga berörda medlems- stater, till berörda flygplatser och till de lufttrafikföretag som bedriver trafik på flyglinjen i fråga.

Kommissionen ska offentliggöra ett meddelande i Europeiska unionens officiella tidning med följande uppgifter:

a)Namnen på de två flygplatser som förbinds med den aktuella flyglinjen och på eventuella mellanlandningsorter.

b)Det datum då den allmänna trafikplikten träder i kraft.

c)Fullständig adress till den plats där texten och all annan relevant information och/eller dokumentation om den allmänna trafikplikten ska tillhandahållas utan dröjsmål och kostnadsfritt av den berörda medlemsstaten.

5.Utan hinder av bestämmelserna i punkt 4 med avseende på flyglinjer där antalet passagerare som förväntas utnyttja flyglinjen understiger 10 000 per år ska meddelandet om allmän trafikplikt offentliggöras antingen i Europeiska unionens officiella tidning eller i den berörda medlemsstatens nationella officiella tidning.

6.En allmän trafikplikt får inte träda i kraft före dagen för offentliggörandet av det meddelande som avses i punkt 4 andra stycket.

7.När allmän trafikplikt föreligger enligt punkterna 1 och 2 får EG-lufttrafikföretagen erbjuda seat only-försäljning, under förut- sättning att den berörda lufttrafiken uppfyller samtliga krav för den allmänna trafikplikten. Den lufttrafiken ska därmed betraktas som regelbunden lufttrafik.

8.När allmän trafikplikt föreligger enligt punkterna 1 och 2 ska EG-lufttrafikföretagen alltid tillåtas att utöva regelbunden lufttrafik som uppfyller alla krav för allmän trafikplikt, inbegripet den driftsperiod som kan krävas i enlighet med punkt 2.

9.Om inget EG-lufttrafikföretag utövar eller kan visa att det står i begrepp att utöva bärkraftig regelbunden lufttrafik på en flyglinje i enlighet med den allmänna trafikplikt som gäller för flyglinjen får den berörda medlemsstaten, utan hinder av bestämmelserna i punkt 8, begränsa tillträde till den regelbundna

L 293/12

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

lufttrafiken på den flyglinjen till endast ett EG-lufttrafikföretag för en period på högst fyra år, varefter situationen ska omprövas.

Denna period kan förlängas upp till fem år om den allmänna trafikplikten införs för en flyglinje till en flygplats som betjänar en region i de yttersta randområdena, enligt artikel 299.2 i fördraget.

10.Rättigheten att utöva lufttrafik på de flyglinjer som nämns i punkt 9 ska erbjudas genom offentligt anbudsförfarande i enlighet med artikel 17, antingen för en flyglinje eller, i fall då det är motiverat med hänsyn till effektiv drift, för ett antal flyglinjer, riktat till alla EG-lufttrafikföretag som är berättigade att utöva sådan lufttrafik. Av administrativa effektivitetsskäl får en medlemsstat utfärda en enda anbudsinfordran som omfattar olika flyglinjer.

11.En allmän trafikplikt ska anses ha upphört att gälla om ingen regelbunden lufttrafik har utförts under en period av tolv månader på den flyglinje som omfattas av en sådan trafikplikt.

12.Om det EG-lufttrafikföretag som valts ut i enlighet med artikel 17 plötsligt avbryter flygtrafiken, får den berörda medlemsstaten, i ett nödläge, efter ömsesidig överenskommelse välja ett annat EG-lufttrafikföretag för fullgörandet av den allmänna trafikplikten för en period av upp till sju månader, som inte får förnyas, på följande villkor:

a)Alla utbetalningar av ersättning från medlemsstaten ska ske i enlighet med artikel 17.8.

b)Valet ska göras bland EG-lufttrafikföretag i överensstäm- melse med principerna om öppenhet och icke-diskriminer- ing.

c)Ett nytt anbudsförfarande ska inledas.

Kommissionen och den eller de berörda medlemsstaterna ska utan dröjsmål informeras om nödförfarandet och om skälen till detta. På begäran av en medlemsstat, eller på eget initiativ, får kommissionen i enlighet med förfarandet i artikel 25.2 tillfälligt stoppa förfarandet om den efter sin utvärdering anser att det inte uppfyller kraven i denna punkt eller på annat sätt strider mot gemenskapsrätten.

Artikel 17

Offentligt anbudsförfarande för allmän trafikplikt

1. Det offentliga anbudsförfarande som krävs enligt arti- kel 16.10 ska genomföras i enlighet med förfarandet i punkterna 2–10 i den här artikeln.

2. Den berörda medlemsstaten ska överlämna hela texten med erbjudandet att delta i anbudsförfarandet till kommissionen

utom när den, i enlighet med artikel 16.5, har tillkännagivit den allmänna trafikplikten genom offentliggörandet av ett medde- lande i den nationella officiella tidningen. I så fall ska anbudsförfarandet också offentliggöras i den nationella officiella tidningen.

3. Ett erbjudande att delta i ett offentligt anbudsförfarande och senare kontrakt ska bland annat omfatta följande punkter:

a)De normkrav som gäller för den allmänna trafikplikten.

b)Regler för ändring och hävning av kontraktet, särskilt med hänsyn till oförutsedda förändringar.

c)Kontraktets giltighetstid.

d)Sanktioner om kontraktet inte uppfylls.

e)Objektiva och öppet redovisade parametrar som ska användas som grundval för beräkning av eventuell ersätt- ning för fullgörande av allmän trafikplikt.

4.Kommissionen ska offentliggöra erbjudandet att delta i anbudsförfarandet genom ett meddelande i Europeiska unionens officiella tidning. Tidsfristen för inlämnande av anbud får inte vara kortare än två månader räknat från dagen för offentliggörandet av ett sådant meddelande. Om anbudet avser en flyglinje till vilken tillträdet redan har begränsats till endast ett lufttrafikföre- tag i enlighet med artikel 16.9, ska erbjudandet att delta i anbudsförfarandet offentliggöras minst sex månader innan löptiden för den nya koncessionen börjar så att det kan prövas huruvida det fortfarande är nödvändigt att begränsa tillträdet.

5.Meddelandet ska innehålla följande uppgifter:

a)Berörd(a) medlemsstat(er).

b)Berörd flyglinje.

c)Kontraktets löptid.

d)Fullständig adress till den plats där texten med erbjudandet att delta i anbudsförfarandet, och all annan relevant information och/eller dokumentation om det offentliga anbudsförfarandet och den allmänna trafikplikten, ska tillhandahållas av den berörda medlemsstaten.

e)Tidsfrist för inlämnande av anbud.

6. Berörda medlemsstater ska utan dröjsmål och kostnadsfritt tillhandahålla alla relevanta upplysningar och handlingar som begärs av en part som berörs av det offentliga anbudsförfarandet.

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/13

 

 

 

 

7.Urvalet bland anbuden ska göras så snart som möjligt och därvid ska hänsyn tas till tjänstens lämplighet, inberäknat de priser och villkor som kan erbjudas kunderna och kostnaden för den eventuella kompensation som krävs från de berörda medlemsstaterna.

8.Den berörda medlemsstaten kan ge ersättning till ett lufttrafikföretag som har valts ut enligt punkt 7 för att det uppfyller de normkrav som gäller för den allmänna trafikplikten enligt artikel 16. Ersättningen får inte överstiga det belopp som krävs för att täcka de nettokostnader som uppkommer vid fullgörandet av varje allmän trafikplikt, med hänsyn till lufttrafikföretagets intäkter i samband därmed samt till en rimlig vinst.

9.Kommissionen ska utan dröjsmål skriftligen informeras om följande uppgifter av medlemsstaten om resultatet av det offentliga anbudsförfarandet och om valet av lufttrafikföretag:

a)Antal anbudsgivare, deras namn samt upplysningar om respektive företag.

b)Driftsrelaterade inslag i anbuden.

c)Ersättning som begärs i anbuden.

d)Namn på den utvalda anbudsgivaren.

10. På begäran av en medlemsstat eller på eget initiativ, får kommissionen anmoda medlemsstater att inom en månad överlämna alla relevanta dokument som rör valet av ett lufttrafikföretag för fullgörandet av en allmän trafikplikt. Om de begärda dokumenten inte överlämnas inom tidsfristen, får kommissionen besluta att tillfälligt stoppa erbjudandet att delta i anbudsförfarandet i enlighet med förfarandet i artikel 25.2.

Artikel 18

Granskning av allmän trafikplikt

1. Medlemsstaterna ska vidta alla nödvändiga åtgärder för att säkerställa att beslut fattade enligt artiklarna 16 och 17 kan omprövas effektivt och, framför allt, så snart som möjligt i de fall då dessa beslut strider mot gemenskapsrätten eller nationella regler för genomförande av gemenskapsrätten.

I synnerhet får kommissionen, på begäran av en medlemsstat eller på eget initiativ, anmoda medlemsstaterna att inom två månader överlämna

a)ett dokument som styrker behovet av den allmänna trafikplikten och dess överensstämmelse med de kriterier som nämns i artikel 16,

b)en analys av regionens ekonomi,

c)en analys av proportionaliteten mellan den planerade trafikplikten och målen för den ekonomiska utvecklingen,

d)en analys av eventuell existerande lufttrafik och av andra tillgängliga transportsätt som skulle kunna anses utgöra en ersättning för den planerade trafikplikten.

2. På begäran av en medlemsstat som anser att utvecklingen av en flyglinje på ett orimligt sätt begränsas av bestämmelserna i artiklarna 16 och 17, eller på eget initiativ, ska kommissionen utföra en undersökning och, inom sex månader efter motta- gandet av begäran och i enlighet med förfarandet i artikel 25.2, fatta ett beslut på grundval av alla relevanta omständigheter om huruvida bestämmelserna i artiklarna 16 och 17 ska fortsätta att gälla för den berörda flyglinjen.

Artikel 19

Fördelning av trafik mellan flygplatser och utövande av trafikrättigheter

1.Utövandet av trafikrättigheter ska regleras av offentliggjorda gemenskapsbestämmelser och nationella, regionala och lokala bestämmelser om säkerhet, luftfartsskydd, miljöskydd samt fördelning av ankomst- och avgångstider.

2.En medlemsstat får efter samråd med berörda parter, inbegripet berörda lufttrafikföretag och flygplatser, reglera fördelningen av flygtrafiken mellan flygplatser som uppfyller nedanstående villkor, om detta sker utan särbehandling av destinationer inom gemenskapen eller på grundval av lufttrafik- företagets nationalitet eller identitet:

a)Flygplatserna betjänar samma stad eller tätortsområde.

b)Flygplatserna omges av ändamålsenlig transportinfrastruk- tur som så långt som det är möjligt erbjuder en direkt förbindelse med möjlighet att nå flygplatsen inom 90 minuter, vid behov även genom att passera en gräns.

c)Flygplatserna är förbundna med varandra och med den stad eller det tätortsområde som de betjänar genom pålitlig och effektiv kollektivtrafik med täta avgångar.

d)Flygplatserna erbjuder lufttrafikföretag nödvändiga tjänster och skadar inte deras kommersiella möjligheter i onödan.

Alla beslut om att reglera fördelningen av lufttrafik mellan de berörda flygplatserna ska fattas under iakttagande av principerna om proportionalitet och öppenhet och ska grundas på objektiva kriterier.

L 293/14

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

3. En berörd medlemsstat ska informera kommissionen om sin avsikt att reglera fördelningen av lufttrafik eller att ändra en befintlig regel för lufttrafik.

Kommissionen ska granska tillämpningen av punkterna 1–2 i denna artikel och, inom sex månader efter mottagandet av informationen från medlemsstaterna och i överensstämmelse med förfarandet i artikel 25.2, besluta huruvida medlemsstaten får tillämpa åtgärderna.

Kommissionen ska offentliggöra sitt beslut i Europeiska unionens officiella tidning och åtgärderna får inte tillämpas före offentlig- görandet av kommissionens godkännande.

4.När det gäller de regler för trafikfördelning som föreligger vid denna förordnings ikraftträdande, ska kommissionen på begäran av en medlemsstat och får kommissionen på eget initiativ pröva en ansökan enligt punkterna 1 och 2 och ska i enlighet med det förfarande som avses i artikel 25.2 avgöra om medlemsstaten får fortsätta att tillämpa åtgärden.

5.Kommissionen ska offentliggöra sina beslut enligt denna artikel i Europeiska unionens officiella tidning.

Artikel 20

Miljöåtgärder

1.Vid allvarliga miljöproblem får den ansvariga medlemsstaten begränsa eller förbjuda utövandet av trafikrättigheter, i synnerhet när andra transportsätt erbjuder lämpliga servicenivåer. Åtgärden ska vara icke-diskriminerande, får inte snedvrida konkurrensen mellan lufttrafikföretag och inte vara mer restriktiv än vad som krävs för att lindra problemen och ska ha en begränsad giltighetstid på högst tre år, varefter den ska omprövas.

2.När en medlemsstat anser att en åtgärd enligt punkt 1 är nödvändig, ska den minst tre månader innan åtgärden träder i kraft underrätta övriga medlemsstater och kommissionen och lämna lämplig motivering för åtgärden. Åtgärden får genomföras om inte någon berörd medlemsstat inom en månad efter mottagande av underrättelsen motsätter sig den eller kommis- sionen tar upp den för ytterligare utredning enligt punkt 3.

3.Kommissionen får i enlighet med förfarandet i artikel 25.2 på begäran av en annan medlemsstat eller på eget initiativ tillfälligt upphäva åtgärderna om de inte uppfyller kraven i punkt 1 eller på annat sätt strider mot gemenskapsrätten.

Artikel 21

Nödåtgärder

1. En medlemsstat får avvisa, begränsa eller införa villkor för utövandet av trafikrättigheter för att lösa plötsligt uppkomna kortvariga problem som uppstått till följd av oförutsebara och oundvikliga omständigheter. Sådana åtgärder ska följa

principerna om proportionalitet och öppenhet och ska grundas på objektiva och icke-diskriminerande kriterier.

Kommissionen och övriga medlemsstater ska genast underrättas om åtgärderna och erhålla en lämplig motivering för dem. Om de problem som gör åtgärderna nödvändiga består i mer än 14 dagar ska medlemsstaten underrätta kommissionen och de andra medlemsstaterna om detta och med kommissionens godkän- nande får medlemsstaten förlänga åtgärderna i ytterligare perioder om högst 14 dagar.

2. Kommissionen får på begäran av de berörda medlemssta- terna eller på eget initiativ tillfälligt upphäva åtgärderna om de inte uppfyller kraven enligt punkt 1 eller om de på något annat sätt strider mot gemenskapsrätten.

KAPITEL IV

BESTÄMMELSER OM PRISSÄTTNING

Artikel 22

Fri prissättning

1.Utan att det påverkar tillämpningen av artikel 16.1, får EG- lufttrafikföretag och, på grundval av ömsesidighet, lufttrafikföre- tag från tredjeländer, fritt sätta sina passagerarpriser och fraktpriser för lufttrafik inom gemenskapen.

2.Utan hinder av bestämmelserna i bilaterala avtal mellan medlemsstater, får medlemsstaterna inte tillämpa diskriminering på grundval av lufttrafikföretags nationalitet eller identitet när EG-lufttrafikföretag tillåts att sätta passagerarpriser och frakt- priser för lufttrafik mellan medlemsstaternas territorier och ett tredjeland. Härmed upphävs alla kvarvarande begränsningar av prissättning, inbegripet för flyglinjer till tredjeländer, vilka härrör från bilaterala avtal mellan medlemsstater.

Artikel 23

Information och icke-diskriminering

1. De passagerarpriser och fraktpriser som är tillgängliga för allmänheten ska innehålla tillämpliga villkor när de erbjuds eller offentliggörs i någon form, inbegripet på Internet, för lufttrafik från en flygplats som befinner sig på en medlemsstats territorium och på vilken fördraget är tillämpligt. Det slutliga pris som ska betalas ska alltid anges och ska innehålla gällande passagerarpris eller fraktpris samt alla tillämpliga skatter och avgifter, tilläggsavgifter och arvoden som är oundvikliga och förutsebara vid tidpunkten för offentliggörandet. Förutom slutpriset ska minst anges

a)passagerarpris eller fraktpris,

b)skatter,

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/15

 

 

 

 

c)flygplatsavgifter, och

d)andra avgifter, tilläggsavgifter eller arvoden, exempelvis sådana som har samband med luftfartsskydd eller bränsle,

om avgifterna i b, c och d har lagts till passagerarpriset eller fraktpriset. Valfria pristillägg ska anges klart, öppet och otvetydigt i början av varje bokningsprocess och kunden ska aktivt markera sitt godkännande av dem.

2. Utan att det påverkar tillämpningen av artikel 16.1 ska tillgång till de passagerarpriser och fraktpriser som är tillgängliga för allmänheten för lufttrafik från en flygplats som befinner sig på en medlemsstats territorium och på vilken fördraget är tillämpligt, ges utan någon diskriminering på grundval av kunders nationalitet eller bosättningsort, eller på grundval av lufttrafikföretagsombudets eller annan biljettförsäljares etable- ringsort inom gemenskapen.

Artikel 24

Sanktioner

Medlemsstaterna ska säkerställa efterlevnad av reglerna i detta kapitel och fastställa sanktioner för överträdelser av dem. Sanktionerna ska vara effektiva, proportionerliga och avskräck- ande.

KAPITEL V

SLUTBESTÄMMELSER

2. När det hänvisas till denna punkt, ska artiklarna 3 och 7 i beslut 1999/468/EG tillämpas, med beaktande av bestämmel- serna i artikel 8 i det beslutet.

Artikel 26

Samarbete och rätt att erhålla information

1.Medlemsstaterna och kommissionen ska samarbeta vid tillämpningen och övervakningen av tillämpningen av denna förordning.

2.För att fullgöra sina skyldigheter enligt denna förordning får kommissionen inhämta all nödvändig information från med- lemsstaterna, som också ska underlätta tillhandahållandet av information från de lufttrafikföretag som deras behöriga tillståndsmyndigheter har utfärdat tillstånd för.

3.Medlemsstaterna ska, i enlighet med sin nationella lagstift- ning, vidta nödvändiga åtgärder för att säkerställa konfidentialitet för den information som de erhåller enligt den här förordningen.

Artikel 27

Upphävande

Förordningarna (EEG) nr 2407/92, (EEG) nr 2408/92 och (EEG) nr 2409/92 ska upphöra att gälla.

Hänvisningar till de upphävda förordningarna ska anses som hänvisningar till den här förordningen och ska läsas i enlighet med jämförelsetabellen i bilaga II.

Artikel 28

Artikel 25

Ikraftträdande

Kommitté

1. Kommissionen ska biträdas av en kommitté.

Denna förordning träder i kraft dagen efter det att den har offentliggjorts i Europeiska unionens officiella tidning.

Denna förordning är till alla delar bindande och direkt tillämplig i alla medlemsstater.

Utfärdad i Strasbourg den 24 september 2008.

 

På Europaparlamentets vägnar

På rådets vägnar

H.-G. PÖTTERING

J.-P. JOUYET

Ordförande

Ordförande

 

 

 

L 293/16

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

BILAGA I

UPPGIFTER SOM SKA TILLHANDAHÅLLAS ENLIGT ARTIKLARNA 5 OCH 8

1.Uppgifter som ska lämnas av företag som ansöker om licens för första gången i fråga om deras ekonomiska ställning.

1.1Den senaste interna driftredovisningen och, om sådana finns, reviderade räkenskaper för det föregående räkenskapsåret.

1.2Budgeterad balansräkning med beräknade resultat för de kommande tre åren.

1.3Underlaget för budgeterade utgifter och inkomster gällande poster såsom bränsle, passagerar- och fraktpriser, löner, underhåll, avskrivningar, valutakursförändringar, flygplatsavgifter, avgifter för flygtrafiktjänster, kostnader för marktjänster, försäkring osv. Trafik/intäktsprognoser.

1.4Utförliga uppgifter om initialkostnader under perioden mellan inlämnandet av ansökningen och driftstarten samt en redogörelse för hur dessa kostnader ska finansieras.

1.5Utförliga uppgifter om nuvarande och planerade finansieringskällor.

1.6Utförliga uppgifter om aktieägare med angivande av nationalitet och planerat aktieslag samt om bolagsordningen. Om företaget ingår i en företagsgrupp ska information om förhållandet mellan företagen lämnas.

1.7Budgeterad kassaflödesanalys och likviditetsplanering för de tre första verksamhetsåren.

1.8Utförliga uppgifter om finansieringen av köp eller leasing av luftfartyg med, i fråga om leasing, angivande av avtalsvillkoren.

2.Uppgifter för bedömning av den fortsatta ekonomiska ställningen som ska lämnas av företag som innehar ett tillstånd och planerar en struktur- eller verksamhetsförändring som påtagligt påverkar dess finansiella situation.

2.1Vid behov den senaste interna balansräkningen och reviderade räkenskaper från det föregående räkenskapsåret.

2.2Utförliga och exakta uppgifter om alla föreslagna förändringar, till exempel förändring av trafikslag, föreslagna förvärv eller sammanslagningar, förändringar av aktiekapitalet, förändringar i fråga om aktieägare osv.

2.3Budgeterad balansräkning med resultaträkning för innevarande räkenskapsår med uppgift om alla föreslagna struktur- eller verksamhetsförändringar som påtagligt påverkar företagets finansiella situation.

2.4Uppgifter om tidigare och budgeterade utgifter och inkomster gällande poster såsom bränsle, passagerar- och fraktpriser, löner, underhåll, avskrivningar, valutakursförändringar, flygplatsavgifter, avgifter för flygtrafiktjänster, kostnader för marktjänster, försäkring osv. Trafik/intäktsprognoser.

2.5Kassaflödesanalys och likviditetsplanering för det kommande året med uppgifter om alla föreslagna struktur- eller verksamhetsförändringar som påtagligt påverkar företagets finansiella situation.

2.6Utförliga uppgifter om finansieringen av köp eller leasing av luftfartyg med, i fråga om leasing, angivande av avtalsvillkoren.

3.Uppgifter för bedömning av den fortsatta ekonomiska ställningen som ska lämnas av företag som redan innehar licens.

3.1Reviderade räkenskaper senast sex månader efter sista dagen för det berörda räkenskapsåret, såvida inget annat föreskrivs i nationell lagstiftning, och vid behov den senaste interna balansräkningen.

31.10.2008

SV

Europeiska unionens officiella tidning

L 293/17

 

 

 

 

3.2Budgeterad balansräkning med resultaträkning för det kommande året.

3.3Uppgifter om tidigare och budgeterade utgifter och inkomster gällande poster såsom bränsle, passagerar- och fraktpriser, löner, underhåll, avskrivningar, valutakursförändringar, flygplatsavgifter, avgifter för flygtrafiktjänster, kostnader för marktjänster, försäkring osv. Trafik/intäktsprognoser.

3.4Kassaflödesanalys och likviditetsplanering för det kommande året.

L 293/18

 

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

 

 

 

 

 

 

BILAGA II

 

 

 

 

 

JÄMFÖRELSETABELL

 

 

 

 

 

(som avses i artikel 27)

 

 

 

 

 

 

 

 

 

 

 

Förordning (EEG) nr 2407/92

 

Den här förordningen

 

 

 

 

 

 

 

 

 

Artikel 1.1

 

 

Artikel 1

 

 

Artikel 1.2

 

 

Artikel 3.3

 

 

Artikel 2

 

 

Artikel 2

 

 

Artikel 3.1

 

 

Artikel 3.2

 

 

Artikel 3.2

 

 

Artikel 3.1 andra stycket

 

 

Artikel 3.3

 

 

Artikel 3.1 första stycket

 

 

Artikel 4.1

 

 

Artikel 4

 

 

Artikel 4.2

 

 

Artikel 4 f

 

 

Artikel 4.3

 

 

 

 

Artikel 4.4

 

 

Artikel 4 f

 

 

Artikel 4.5

 

 

Artikel 8.1 andra stycket

 

 

Artikel 5.1

 

 

Artikel 5.1

 

 

Artikel 5.2

 

 

Artikel 5.2

 

 

Artikel 5.3

 

 

Artikel 8.5

 

 

Artikel 5.4

 

 

Artikel 8.6

 

 

Artikel 5.5

 

 

Artikel 9.1

 

 

Artikel 5.6

 

 

Artikel 8.4

 

 

Artikel 5.7

 

 

Artikel 5.3 och artikel 8.8

 

 

Artikel 6

 

 

Artikel 7

 

 

Artikel 7

 

 

Artikel 11

 

 

Artikel 8.1

 

 

Artikel 4c

 

 

Artikel 8.2

 

 

Artikel 12.1

 

 

Artikel 8.3

 

 

Artikel 13.2 och 13.3

 

 

Artikel 8.4

 

 

Artikel 12.2

 

 

Artikel 9

 

 

Artikel 6

 

 

Artikel 10.1

 

 

Artikel 13.2 och 13.3

 

 

Artikel 10.2

 

 

Artikel 13.2 och 13.3

 

 

Artikel 11.1

 

 

Artikel 8.1

 

 

Artikel 11.2

 

 

Artikel 8.3

 

 

Artikel 11.3

 

 

Artikel 8.7

 

 

Artikel 12

 

 

Artikel 9.2 –9.6

 

 

Artikel 13.1

 

 

Artikel 10.2

 

 

Artikel 13.2

 

 

Artikel 10.1

 

 

Artikel 13.3

 

 

 

 

Artikel 13.4

 

 

Artikel 10.3

 

 

Artikel 14

 

 

 

 

Artikel 15

 

 

 

 

Artikel 16

 

 

 

 

Artikel 17

 

 

 

 

Artikel 18.1

 

 

Artikel 26.1

 

 

Artikel 18.2

 

 

Artikel 26.3

 

 

Artikel 19

 

 

 

 

BILAGA

 

 

BILAGA I

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Förordning (EEG) nr 2408/92

 

Den här förordningen

 

 

 

 

 

 

 

 

 

Artikel 1.1

 

 

Artikel 1

 

 

Artikel 1.2

 

 

Artikel 1.2

 

 

Artikel 1.3

 

 

 

 

Artikel 1.4

 

 

 

31.10.2008

 

SV

Europeiska unionens officiella tidning

L 293/19

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Förordning (EEG) nr 2408/92

Den här förordningen

 

 

 

 

 

 

 

 

Artikel 2

 

Artikel 2

 

 

Artikel 3.1

 

Artikel 15.1 och 15.2

 

 

Artikel 3.2

 

 

 

Artikel 3.3

 

 

 

Artikel 3.4

 

 

 

Artikel 4.1 a

 

Artikel 16.1

 

 

Artikel 4.1 b

 

Artikel 16.3

 

 

Artikel 4.1 c

 

Artikel 16.2

 

 

Artikel 4.1 d

 

Artikel 16.9

 

 

 

Artikel 17.1

 

 

 

Artikel 17.2

 

 

 

Artikel 17.4

 

 

 

Artikel 17.5

 

 

 

Artikel 17.6

 

 

Artikel 4.1 e

 

Artikel 17.3

 

 

Artikel 4.1 f

 

Artikel 17.7

 

 

Artikel 4.1 g

 

 

 

Artikel 4.1 h

 

Artikel 17.8

 

 

 

Artikel 17.9

 

 

 

Artikel 17.10

 

 

Artikel 4.1 i

 

Artikel 18.1

 

 

Artikel 4.1 j

 

Artikel 16.7

 

 

Artikel 4.1 k

 

 

 

Artikel 4.2

 

 

 

Artikel 4.3

 

Artikel 18.2

 

 

Artikel 4.4

 

 

 

Artikel 5

 

 

 

Artikel 6.1 och 6.2

 

 

Artikel 7

 

Artikel 15.4 och 15.5

 

 

Artikel 8.1

 

Artikel 19.2

 

 

Artikel 8.2

 

Artikel 19.1

 

 

Artikel 8.3

 

Artikel 19.3

 

 

Artikel 8.4

 

 

 

Artikel 8.5

 

 

 

Artikel 9.1

 

Artikel 20.1

 

 

Artikel 9.2

 

Artikel 20.1

 

 

Artikel 9.3

 

Artikel 20.2

 

 

Artikel 9.4

 

Artikel 20.3

 

 

Artikel 9.5

 

Artikel 22.1

 

 

Artikel 9.6

 

Artikel 22.2

 

 

Artikel 9.7

 

 

 

Artikel 9.8

 

 

 

Artikel 10

 

 

 

Artikel 11

 

Artikel 25

 

 

Artikel 12.1

 

Artikel 26.2

 

 

Artikel 12.2

 

 

 

Artikel 13

 

 

 

Artikel 14.1

 

Artikel 26.1

 

 

Artikel 14.2

 

Artikel 26.3

 

 

Artikel 15

 

 

 

Artikel 16

 

 

 

BILAGA I

 

 

 

BILAGA II

 

 

 

BILAGA III

 

 

 

 

BILAGA II

 

 

 

 

 

 

 

L 293/20

 

SV

Europeiska unionens officiella tidning

31.10.2008

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Förordning (EEG) nr 2409/92

 

Den här förordningen

 

 

 

 

 

 

 

 

Artikel 1.1

 

Artikel 1

 

 

 

Artikel 1.2

 

Artikel 21.1

 

 

 

Artikel 1.3

 

 

 

 

Artikel 2

 

Artikel 2

 

 

 

Artikel 3

 

 

 

 

Artikel 4

 

Artikel 23

 

 

 

Artikel 5.1

 

Artikel 22

 

 

 

Artikel 5.2

 

 

 

 

Artikel 5.3

 

 

 

 

Artikel 5.4

 

 

 

 

Artikel 6

 

 

 

 

Artikel 7

 

 

 

 

Artikel 8

 

 

 

 

Artikel 9

 

 

 

 

Artikel 10.1

 

Artikel 26.1

 

 

 

Artikel 10.2

 

Artikel 26.3

 

 

 

Artikel 11

 

 

 

 

Artikel 12

 

 

 

 

 

Artikel 27

 

 

 

 

Artikel 28

 

 

 

 

 

 

 

 

 

Prop. 2013/14:239

Bilaga 5

126

Sammanfattning av departementspromemorian Lag om resenärers rättigheter – kompletterande bestämmelser (Ds 2013:44)

Promemorian behandlar i huvudsak frågor som rör tre EU-förordningar om resenärsrättigheter: tågpassagerarförordningen, (EG) nr 1371/2007, fartygspassagerarförordningen, (EU) nr 1177/2010, och busspassagerar- förordningen, (EU) nr 181/2011. Det lämnas förslag till hur förord- ningarnas tillämpningsområden bör avgränsas i förhållande till det förslag till lag om resenärers rättigheter i lokal och regional kollektiv- trafik som har lämnats av Utredningen om en ny kollektivtrafiklag (SOU 2009:81). Också andra frågor om förordningarnas tillämpning i Sverige behandlas. Det föreslås också lagbestämmelser som kompletterar förord- ningarna i vissa avseenden. Merparten av bestämmelserna föreslås bli införda i en ny lag om resenärers rättigheter. Avsikten är att lagen också ska reglera de frågor som omfattas av lagförslaget i SOU 2009:81.

När det gäller förordningarnas tillämpningsområden föreslås en avgränsning som möjliggör att lokal och regional trafik med tåg och buss kan omfattas av en nationell trafikslagsövergripande lagstiftning. Förslaget kompletterar lagförslaget i SOU 2009:81. Den enskilda transportsträckans längd föreslås bli styrande för om transporten ska anses regional eller mer långväga. I princip ska transporter som är kortare än 100 km regleras av den nationella trafikslagsövergripande lagstift- ningen medan längre transporter ska regleras av tåg- och busspassagerar- förordningarna. För att skapa utrymme för den nationella lagstiftningen föreslås ett undantag från merparten av bestämmelserna i tågpassagerar- förordningen vid inrikes transporter som är kortare än 100 km. Vidare föreslås att merparten av busspassagerarförordningens bestämmelser ska gälla också vid inrikes transporter som är 100 km eller längre. Något motsvarande undantag från fartygspassagerarförordningen föreslås inte. Det innebär att lokala och regionala fartygstransporter inte ska omfattas av den nationella trafikslagsövergripande lagstiftningen utan av fartygs- passagerarförordningen.

Tåg-, fartygs- och busspassagerarförordningarna ger möjlighet till vissa andra undantag. Bl.a. kan medlemsstaterna fördröja tillämpningen av stora delar av förordningarna på inrikes trafik. Promemorians förslag är att ingen av dessa andra undantagsmöjligheter ska utnyttjas.

EU:s medlemsstater är skyldiga att ha sanktioner som gäller vid överträdelser av tåg-, fartygs- och busspassagerarförordningarna. Samma krav gäller vid överträdelser av vissa konsumenträttsliga bestämmelser i EU-förordningen om gemensamma regler för tillhandahållande av lufttrafik i gemenskapen. Även ett krav på information om passagerar- rättigheter i den EU-rättsliga Atenförordningen behöver sanktioneras. I promemorian föreslås att marknadsföringslagens sanktionsbestämmelser ska tillämpas om den informationsskyldighet som anges i förordningarna inte uppfylls. Vidare föreslås en särskild marknadsrättslig sanktion vid överträdelser av andra bestämmelser i EU-förordningarna som är av konsumenträttslig karaktär. Det föreslås också bemyndiganden för Transportstyrelsen att besluta om sanktioner i vissa fall.

Härutöver föreslås en bestämmelse om reklamation för att skydda resenärer vid transporter som omfattas av tågpassagerarförordningen. Om det i transportavtalet ställs krav på att reklamation ska ske inom en viss tid, får denna tid inte understiga två månader från den dag transport- tjänsten utfördes eller borde ha utförts. Det föreslås också en skyldighet för transportörer inom tåg-, fartygs-, buss-, tunnelbane- och spårvagns- trafik att ha riktlinjer avseende resenärernas möjligheter att skaffa biljetter. Riktlinjerna ska innehålla en redovisning av samtliga de villkor som gäller för en resenärs tillgång till biljetter. Överläggning om rikt- linjerna ska ske med Konsumentverket och organisationer som företräder resenärsintressen och transportörerna ska tillhandahålla allmänheten information om innehållet i sina riktlinjer. Konsumentverket ska även utöva tillsyn över att transportörer har riktlinjer med föreskrivet innehåll och att information om innehållet tillhandahålls allmänheten. Om en transportör inte fullgör dessa skyldigheter, ska marknadsrättsliga sanktioner kunna användas.

Prop. 2013/14:239

Bilaga 5

127

Prop. 2013/14:239

Bilaga 6

Promemorians lagförslag

Förslag till lag om resenärers rättigheter (vissa paragrafer)

Härigenom föreskrivs följande.

EU-rättsliga bestämmelser om resenärers rättigheter 1 § Bestämmelser om resenärers rättigheter finns i

1.Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer1,

2.Europaparlamentets och rådets förordning (EU) nr 1177/2010 av den

24 november 2010 om passagerares rättigheter vid resor till sjöss och på inre vattenvägar och om ändring av förordning (EG) nr 2006/20042, och

3.Europaparlamentets och rådets förordning (EU) nr 181/2011 av den

16 februari 2011 om passagerares rättigheter vid busstransport och om ändring av förordning (EG) nr 2006/20043.

Artiklarna 7, 8, 10.1, 10.4, 15–18 och 22–24 i förordning (EG) nr 1371/2007 ska inte tillämpas på inrikes tågresor och järnvägstjänster där transporten enligt tidtabell

1.tar mindre än 60 minuter och är kortare än 150 km, eller

2.är kortare än 100 km.

I den utsträckning en fråga regleras av någon av de förordningar som anges i första stycket, tillämpas inte svensk lag.

Utvidgad tillämpning av busspassagerarförordningen

2 § Utöver vad som anges i förordning (EU) nr 181/2011 ska vad som sägs i artiklarna 3, 4.1, 5, 6, 8, 10.2–10.5, 11, 13–16.1 a, 17.3 och 19–23 i den förordningen gälla vid transporter med buss i linjetrafik för icke specificerade passagerarkategorier, om påstigningsplatsen eller avstigningsplatsen är belägen i Sverige och transporten enligt tidtabell tar 80 minuter eller mer och är 100 km eller längre.

Tillsyn över att förordningarna följs

3 § Den eller de myndigheter som regeringen bestämmer utövar tillsyn över att de skyldigheter som följer av förordning (EG) nr 1371/2007, förordning (EU) nr 1177/2010 och förordning (EU) nr 181/2011 fullgörs.

Reklamation vid tågtransporter

4 § Om det i ett avtal om en transport som omfattas av artiklarna 15–18 i förordning (EG) nr 1371/2007 uppställs krav på att den som vill åberopa en försening, utebliven anslutning eller inställd avgång ska anmäla detta

1EUT L 315, 3.12.2007, s. 14 (Celex 32007R1371).

2EUT L 334, 17.12.2010, s. 1 (Celex 32010R1177).

3EUT L 55, 28.2.2011, s. 1 (Celex 32011R0181).

128

inom viss tid (reklamation), får tiden inte understiga två månader från

Prop. 2013/14:239

den dag transporttjänsten utfördes eller borde ha utförts.

Bilaga 6

Om ett meddelande om reklamation har lämnats in för befordran med

 

post eller avsänts på annat ändamålsenligt sätt, anses reklamation ha skett

 

när detta gjordes.

 

Riktlinjer för tillgång till biljetter

5 § En transportör som yrkesmässigt tillhandahåller allmänheten persontransporter enligt offentliggjord tidtabell med tåg, fartyg, buss, tunnelbanetåg eller spårvagn ska ha riktlinjer avseende resenärernas till- gång till biljetter.

De riktlinjer som avses i första stycket ska innehålla en redovisning av

1.de förutsättningar som en resenär har att boka en biljett,

2.det eller de sätt, inklusive betalningssätt, som en resenär kan använda sig av för att köpa en biljett,

3.vilket eller vilka sätt att distribuera en biljett som erbjuds en resenär,

4.de eventuella andra villkor som gäller för en resenärs tillgång till biljetter, och

5.de särskilda åtgärder som transportören har vidtagit för att underlätta tillgången till biljetter för resenärer i olika åldersgrupper och för resenärer med funktionsnedsättning eller nedsatt rörlighet.

6 § Innan en transportör antar eller ändrar riktlinjer som avses i 5 § ska överläggning ske med Konsumentverket och organisationer som företräder resenärerna. Transportören ska beakta de synpunkter som Konsumentverket och resenärsorganisationerna lämnar.

Konsumentverket ska leda överläggningar enligt första stycket och bestämma vilka resenärsorganisationer som ska få tillfälle att delta.

Konsumentverket får vid behov kalla till nya överläggningar om en transportörs riktlinjer.

7 § En transportör som enligt 5 § första stycket är skyldig att ha riktlinjer ska tillhandahålla allmänheten information om innehållet i riktlinjerna.

8 § Konsumentverket ska utöva tillsyn över att transportörer fullgör de skyldigheter som följer av 5 och 7 §§.

Sanktioner

9 § Om information inte lämnas enligt 7 § eller enligt

1.artikel 4, 8, 9.5, 18.1, 20, 22.3 eller 29 i förordning (EG) nr 1371/2007,

2.artikel 8.5, 9.2, 9.3, 9.4, 10, 12.3, 13.3, 16, 22 eller 23 i förordning (EU) nr 1177/2010,

3.artikel 11.2, 11.3, 11.4, 11.5, 14.5, 20, 24 eller 25 i förordning (EU) nr 181/2011, eller

129

Prop. 2013/14:239

4. artikel 7 i Europaparlamentets och rådets förordning (EG) nr

Bilaga 6

392/2009 av den 23 april 2009 om transportörens skadeståndsansvar i

 

samband med olyckor vid passagerarbefordran till sjöss4

 

ska marknadsföringslagen (2008:486) tillämpas, med undantag för 29–

 

36 §§ om marknadsstörningsavgift. Sådan information ska anses vara

 

väsentlig enligt 10 § tredje stycket den lagen.

10 § Ett järnvägsföretag, en biljettutfärdare, en stationsförvaltare, en researrangör, en transportör, en resebyrå eller en terminaloperatör som inte uppfyller de skyldigheter som följer av 5 § eller av

1.artikel 9.1, 9.2, 9.3, 9.4, 19, 22.1, 23, 24, 27 eller 28 i förordning (EG) nr 1371/2007,

2.artikel 4, 7, 8.1, 8.2, 8.3, 8.4, 9.1, 10, 11, 12, 13.1, 13.2 eller 24 i förordning (EU) nr 1177/2010, eller

3.artikel 4, 9, 10, 11.1, 13, 14, 15, 26 eller 27 i förordning (EU) nr 181/2011,

iannat avseende än vad som avses i 9 §, får vid vite åläggas att göra detta.

Talan om åläggande enligt första stycket väcks vid Marknadsdomstolen av Konsumentombudsmannen.

11 § I ett fall som inte är av större vikt får Konsumentombudsmannen meddela föreläggande om sådant åläggande som avses i 10 §.

För ett föreläggande enligt första stycket gäller vad som sägs i 28 § marknadsföringslagen (2008:486).

12 § Den myndighet som utövar tillsyn över att de skyldigheter som följer av artikel 14 i förordning (EU) nr 1177/2010 och artikel 16.1 i förordning (EU) nr 181/2011 fullgörs, får meddela de förelägganden som behövs för att bestämmelserna ska efterlevas.

Förelägganden enligt första stycket får förenas med vite. Tillsynsmyndighetens beslut enligt denna paragraf får överklagas till

allmän förvaltningsdomstol. Prövningstillstånd krävs vid överklagande till kammarrätten.

Fullt tillgängliga bussterminaler

13 § Regeringen ska utse bussterminaler där assistans för personer med funktionsnedsättning eller nedsatt rörlighet ska tillhandahållas i enlighet med förordning (EU) nr 181/2011.

Regeringen får överlåta åt en statlig myndighet eller de regionala kollektivtrafikmyndigheter som avses i lagen (2010:1065) om kollektivtrafik att utse bussterminaler enligt första stycket.

1.Denna lag träder i kraft den 1 juli 2014.

2.Bestämmelsen i 4 § om reklamation vid tågtransporter gäller inte för transporter där transportavtalet ingåtts före lagens ikraftträdande.

4 EUT L 131, 28.5.2009, s. 24 (Celex 32009R0392).

130

3. Skyldigheterna enligt 5 och 7 §§ att ha riktlinjer respektive att tillhandahålla information om innehållet i riktlinjerna gäller först från och med den 1 juli 2015.

Prop. 2013/14:239

Bilaga 6

131

Prop. 2013/14:239

Bilaga 6

Förslag till lag om ändring i lagen (1970:417) om marknadsdomstol m.m.

Härigenom föreskrivs att 1 § lagen (1970:417) om marknadsdomstol m.m.1 ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

1 §2 Marknadsdomstolen handlägger mål och ärenden enligt

1.konkurrenslagen (2008:579),

2.marknadsföringslagen (2008:486),

3.lagen (1994:1512) om avtalsvillkor i konsumentförhållanden,

4.lagen (1984:292) om avtalsvillkor mellan näringsidkare,

5.lagen (2000:1175) om talerätt för vissa utländska konsument- myndigheter och konsumentorganisationer,

6.försäkringsavtalslagen (2005:104),

7.lagen (2005:590) om insyn i vissa finansiella förbindelser m.m.,

8.lagen (2006:484) om franchisegivares informationsskyldighet,

9.lagen (2010:510) om lufttransporter,

10. lagen

(1986:436)

om

10. lagen

(1986:436)

 

om

näringsförbud, och

 

 

näringsförbud,

 

 

 

 

 

11. lagen

(2010:1350)

om

11. lagen

(2010:1350)

 

om

uppgiftsskyldighet

i

fråga

om

uppgiftsskyldighet

i

 

fråga

om

marknads-

och

konkurrens-

marknads-

och

 

konkurrens-

förhållanden.

 

 

 

 

förhållanden, och

 

 

 

 

 

 

 

 

 

 

 

12. lagen

(2014:000)

 

om

 

 

 

 

 

 

resenärers rättigheter.

 

 

 

 

Bestämmelserna

i

14–22

§§

Bestämmelserna

i

 

14–22

§§

tillämpas inte i mål eller ärenden

tillämpas inte i mål eller ärenden

enligt konkurrenslagen, marknads-

enligt konkurrenslagen, marknads-

föringslagen,

försäkringsavtals-

föringslagen,

försäkringsavtals-

lagen, lagen om insyn i vissa

lagen, lagen om insyn i vissa

finansiella

förbindelser m.m.,

finansiella

 

förbindelser

m.m.,

lagen

om

 

franchisegivares

lagen

om

 

franchisegivares

informationsskyldighet,

lagen

om

informationsskyldighet,

13

 

eller

lufttransporter,

 

lagen

om

15 § lagen om lufttransporter,

näringsförbud

eller

lagen

om

lagen om näringsförbud, lagen om

uppgiftsskyldighet

i

fråga

om

uppgiftsskyldighet

i

 

fråga

om

marknads- och konkurrensförhåll-

marknads-

och

 

konkurrens-

anden. I mål enligt marknads-

förhållanden

eller

9 §

lagen

om

föringslagen,

försäkringsavtals-

resenärers rättigheter. I mål enligt

lagen eller lagen om franchise-

marknadsföringslagen,

 

 

 

 

givares

informationsskyldighet

försäkringsavtalslagen

 

eller

lagen

tilllämpas

inte heller

13 a §. I

om franchisegivares informations-

1Lagen omtryckt 1984:294.

2Senaste lydelse 2010:1352.

132

stället gäller rättegångsreglerna i

skyldighet

tilllämpas inte

heller

Prop. 2013/14:239

dessa lagar.

13 a §. I

stället gäller

rätte-

Bilaga 6

 

gångsreglerna i dessa lagar.

 

 

Denna lag träder i kraft den 1 juli 2014.

133

Prop. 2013/14:239

Bilaga 6

Förslag till lag om ändring i järnvägstrafiklagen (1985:192)

Härigenom föreskrivs att 1 kap. 1 § järnvägstrafiklagen (1985:192) ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

1 kap.

1 §1

Denna lag tillämpas på järnvägstrafik på bana inom Sverige eller på svensk tågfärja. Vad som föreskrivs om järnväg i 1 kap., 2 kap. 2–5 §§ och 5 kap. tillämpas också på tunnelbana och spårväg.

Av 2 kap. 4 § och 3 kap. 1 §

Av 2 kap. 4 § och 3 kap. 1 §

följer att vissa bestämmelser i

följer att vissa bestämmelser i

lagen tillämpas även på befordran

lagen tillämpas även på befordran

med annat transportmedel än som

med annat transportmedel än som

anges i första stycket. I fall som

anges i första stycket. I fall som

avses i 2 kap. 4 § kan därvid

avses i 2 kap. 4 § kan därvid

bestämmelser i lagen tillämpas på

bestämmelser i lagen tillämpas på

befordran även utom Sverige.

befordran

även

utom

Sverige.

Enligt 2 kap. 1 §, 3 kap. 1 § och 4

Enligt 2 kap. 1 §, 3 kap. 1 § och 4

kap. 1 § skall lagen i vissa fall inte

kap. 1 § ska lagen i vissa fall inte

tillämpas på befordran i trafik med

tillämpas på befordran i trafik med

utlandet.

utlandet.

 

 

 

Lagen tillämpas inte på brevbefordran med järnväg.

 

 

 

Lagen tillämpas inte i den

 

utsträckning en fråga regleras av

 

Europaparlamentets och

rådets

 

förordning (EG) nr 1371/2007 av

 

den 23 oktober 2007 om

 

rättigheter

och

skyldigheter för

 

tågresenärer2.

 

 

Denna lag träder i kraft den 1 juli 2014.

1Senaste lydelse 1998:485.

2EUT L 315, 3.12.2007, s. 14 (Celex 32007R1371).

134

Förslag till lag om ändring i lagen (1985:193) om internationell järnvägstrafik

Härigenom föreskrivs att 1 § lagen (1985:193) om internationell järnvägstrafik ska ha följande lydelse.

Prop. 2013/14:239

Bilaga 6

Nuvarande lydelse

Föreslagen lydelse

1 §1

Denna lag tillämpas på sådan internationell järnvägsbefordran som avses i det i bilaga 1 intagna fördraget den 9 maj 1980 om internationell järnvägstrafik (COTIF) ändrat enligt det protokoll den 20 december 1990 som är intaget i bilaga 6 till denna lag.

Lagen tillämpas inte i den utsträckning en fråga regleras av Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer2.

Denna lag träder i kraft den 1 juli 2014.

1Senaste lydelse 1995:369.

2EUT L 315, 3.12.2007, s. 14 (Celex 32007R1371).

135

Prop. 2013/14:239

Bilaga 6

Förslag till lag om ändring i lagen (1992:1672) om paketresor

Härigenom föreskrivs att 18 § lagen (1992:1672) om paketresor ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

18 §1

Skador som omfattas av bestämmelserna i sjölagen (1994:1009), rådets förordning (EG) nr 2027/97 av den 9 oktober 1997 om lufttrafikföretags skadeståndsansvar avseende lufttransport av passagerare och deras bagage, lagen (2010:510) om lufttransporter, järnvägstrafik- lagen (1985:192) eller lagen (1985:193) om internationell järnvägstrafik ersätts enligt de bestämmelserna i stället för enligt denna lag. Arrangören är dock alltid skyldig att ersätta resenären för vad denne har rätt att fordra enligt de nämnda bestämmelserna.

Skador som omfattas av bestämmelserna i

sjölagen (1994:1009),

rådets förordning (EG) nr 2027/97 av den 9 oktober 1997 om lufttrafikföretags skade- ståndsansvar avseende luft- transport av passagerare och deras bagage,

lagen (2010:510) om luft- transporter,

Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007

om rättigheter och skyldigheter för tågresenärer2,

järnvägstrafiklagen (1985:192), eller

lagen (1985:193) om internationell järnvägstrafik

ersätts enligt de bestämmelserna

istället för enligt denna lag. Arrangören är dock alltid skyldig att ersätta resenären för vad denne har rätt att fordra enligt de nämnda bestämmelserna.

Denna lag träder i kraft den 1 juli 2014.

1Senaste lydelse 2010:514.

2EUT L 315, 3.12.2007, s. 14, (Celex 32007R1371).

136

Förslag till lag om ändring i sjölagen (1994:1009)

Prop. 2013/14:239

Härigenom föreskrivs att 15 kap. 2 § sjölagen (1994:1009) ska ha

Bilaga 6

 

följande lydelse.

 

 

Nuvarande lydelse

Föreslagen lydelse

 

 

15 kap.

 

 

2 §

 

Bestämmelserna i detta kapitel gäller inte i den mån befordringen är underkastad ett gällande internationellt fördrag om befordran med annat transportmedel.

Bestämmelserna i detta kapitel tillämpas inte i den utsträckning en fråga regleras av Europaparlamentets och rådets förordning (EU) nr 1177/2010 av den 24 november 2010 om passagerares rättigheter vid resor till sjöss och på inre vattenvägar och om ändring av förordning (EG) nr 2006/2004. Bestämm- elserna tillämpas inte heller i den utsträckning befordringen är underkastad ett gällande inter- nationellt fördrag om befordran med annat transportmedel.

Denna lag träder i kraft den 1 juli 2014.

137

Prop. 2013/14:239

Bilaga 6

138

Förslag till lag om ändring i järnvägslagen (2004:519)

Härigenom föreskrivs att 1 kap. 2 § och 8 kap. 4 och 5 §§ järnvägslagen (2004:519) ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

1 kap.

2 §

Särskilda bestämmelser om befordran av passagerare och gods finns i järnvägstrafiklagen (1985:192) och i lagen (1985:193) om internationell järnvägstrafik.

Särskilda bestämmelser om transport av passagerare finns i Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer1. Särskilda bestämmelser om transport av passagerare och gods finns även i järnvägstrafiklagen (1985:192) och i lagen (1985:193) om inter- nationell järnvägstrafik.

8 kap.

 

4 §2

 

 

 

Tillsynsmyndigheten

får

Tillsynsmyndigheten

får

meddela de förelägganden

och

meddela de

förelägganden

och

förbud som behövs för att denna

förbud som behövs för att artikel

lag eller de föreskrifter eller

10.1, 10.2, 10.4, 21 eller 26 i

villkor som har meddelats med

förordning

(EG) nr 1371/2007

stöd av lagen ska efterlevas.

 

eller denna lag eller de föreskrifter

 

 

eller villkor som har meddelats

 

 

med stöd av lagen ska efterlevas.

Förelägganden och förbud får förenas med vite.

Har någon ålagts att betala konkurrensskadeavgift enligt 3 kap. 5 § konkurrenslagen (2008:579) eller dömts att betala vite enligt 6 kap. 2 § samma lag, får vite enligt denna lag inte dömas ut för samma förfarande.

Om någon har ålagts att betala konkurrensskadeavgift enligt 3 kap. 5 § konkurrenslagen (2008:579) eller dömts att betala vite enligt 6 kap. 2 § samma lag, får vite enligt denna lag inte dömas ut för samma förfarande.

1EUT L 315, 3.12.2007, s. 14 (Celex 32007R1371).

2Senaste lydelse 2008:602.

5 §3 Tillsynsmyndigheten får återkalla ett tillstånd om

1. förutsättningarna för tillståndet inte längre uppfylls,

2. tillståndshavaren inte

fullgör

2. tillståndshavaren

inte

fullgör

sina skyldigheter enligt denna lag

sina skyldigheter

enligt

artikel

eller enligt föreskrifter

som

10.1, 10.2, 10.4, 21 eller 26 i

meddelats med stöd av lagen, eller

förordning (EG)

nr

1371/2007,

 

 

denna lag eller föreskrifter som

 

 

meddelats med stöd av lagen, eller

3. tillståndshavaren under minst sex månader inte använder en licens enligt 3 kap. 2 § eller under minst ett år inte använder ett annat tillstånd enligt 3 kap.

Denna lag träder i kraft den 1 juli 2014.

3 Senaste lydelse 2007:452.

Prop. 2013/14:239

Bilaga 6

139

Prop. 2013/14:239

Bilaga 6

Förslag till lag om ändring i lagen (2006:1116) om information till passagerare m.m.

Härigenom föreskrivs att 1 § lagen (2006:1116) om information till passagerare m.m. ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

1 §1

Denna lag gäller för den som utför transporter av passagerare i linjetrafik med buss eller som utför motsvarande trafik med tåg, tunnelbana eller spårvagn (transportör). Begreppet linjetrafik har samma innebörd som i 1 kap. 5 § 1 i yrkestrafiklagen (2012:210).

I de fall då trafiken organiseras av en regional kollektivtrafikmyndighet enligt lagen (2010:1065) om kollektivtrafik gäller lagens bestämmelser om transportör i stället beträffande myndigheten, även om denne inte själv utför trafiken.

Lagen gäller inte för den som utför trafik med museijärnvägsfordon eller liknande trafik.

Lagen tillämpas inte i den utsträckning en fråga regleras av Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer2 eller Europaparla- mentets och rådets förordning (EU) nr 181/2011 av den 16 februari 2011 om passagerares rättigheter vid busstransport och om ändring av förordning (EG) nr 2006/20043.

Denna lag träder i kraft den 1 juli 2014.

1Senaste lydelse 2012:223.

2EUT L 315, 3.12.2007, s. 14 (Celex 32007R1371).

3EUT L 55, 28.2.2011, s. 1 (Celex 32011R0181).

140

Förslag till lag om ändring i marknadsföringslagen (2008:486)

Härigenom föreskrivs att 1 § marknadsföringslagen (2008:486) ska ha följande lydelse.

Prop. 2013/14:239

Bilaga 6

Nuvarande lydelse

Föreslagen lydelse

1 §1

Denna lag har till syfte att främja konsumenternas och näringslivets intressen i samband med marknadsföring av produkter och att motverka marknadsföring som är otillbörlig mot konsumenter och näringsidkare.

Bestämmelser om marknadsföring finns bl.a. i

lagen (1992:1672) om paketresor,

tobakslagen (1993:581),

lagen (1995:1571) om insättningsgaranti,

lagen (1996:1006) om anmälningsplikt avseende viss finansiell verksamhet,

lagen (1996:1118) om marknadsföring av kristallglas,

lagen (1999:268) om betalningsöverföringar inom Europeiska ekonomiska samarbetsområdet,

lagen (1999:158) om investerarskydd,

lagen (2002:562) om elektronisk handel och andra informations- samhällets tjänster,

lagen (2004:299) om inlåningsverksamhet,

prisinformationslagen (2004:347),

distans- och hemförsäljningslagen (2005:59),

försäkringsavtalslagen (2005:104),

lagen (2005:405) om försäkringsförmedling,

lagen (2006:484) om franchisegivares informationsskyldighet,

lagen (2010:510) om lufttransporter,

radio- och tv-lagen (2010:696),

alkohollagen (2010:1622),

konsumentkreditlagen

(2010:1846), och

lagen (2011:914) om konsumentskydd vid avtal om tidsdelat boende eller långfristig semesterprodukt.

konsumentkreditlagen

(2010:1846),

lagen (2011:914) om konsumentskydd vid avtal om tidsdelat boende eller långfristig semesterprodukt, och

lagen (2014:000) om rese- närers rättigheter.

Denna lag träder i kraft den 1 juli 2014.

1 Senaste lydelse 2011:915.

141

Bilaga 6

142

Förslag till lag om ändring i lagen (2010:510) om lufttransporter

Härigenom föreskrivs att 14–17 §§ samt rubriken närmast före 14 § lagen (2010:510) om lufttransporter ska ha följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

Bestämmelser i anledning av

Bestämmelser i anledning av

förordning (EG) nr 261/2004,

förordning (EG) nr 261/2004,

förordning (EG) nr 2111/2005

förordning (EG) nr 2111/2005,

och förordning (EG) nr

förordning (EG) nr 1107/2006

1107/2006

och förordning (EG) nr

 

1008/2008

14 § Konsumentverket ska utöva tillsyn över

1. att lufttrafikföretag fullgör de skyldigheter som följer av förordning (EG) nr 261/2004,

2. att

lufttrafikföretag,

 

rese-

2. att

lufttrafikföretag,

rese-

arrangörer

och

biljettförsäljare

arrangörer och

biljettförsäljare

fullgör de skyldigheter som följer

fullgör de skyldigheter som följer

av artiklarna 11 och 12 i

av artiklarna 11 och 12 i

förordning

(EG)

nr

2111/2005,

förordning (EG) nr 2111/2005,

samt

 

 

 

 

 

 

 

 

 

 

3. att

lufttrafikföretag,

deras

3. att

lufttrafikföretag,

deras

agenter och researrangörer fullgör

agenter och researrangörer fullgör

de skyldigheter som följer av

de skyldigheter som följer av

artiklarna 3 och 4 i förordning

artiklarna 3 och 4 i förordning

(EG) nr 1107/2006.

 

 

 

 

(EG) nr 1107/2006, samt

 

 

 

 

 

 

 

 

4. att

lufttrafikföretag,

deras

 

 

 

 

 

 

 

agenter

och

researrangörer

 

 

 

 

 

 

 

fullgör de skyldigheter som följer

 

 

 

 

 

 

 

av artikel 23 i förordning (EG) nr

 

 

 

 

 

 

 

1008/2008.

 

 

 

 

 

 

 

 

15 §

 

 

 

 

Ett

åläggande

 

att

lämna

Om

information

inte

lämnas

föreskriven

information

 

får

enligt

 

 

 

meddelas

 

 

 

 

 

– artikel 14 i förordning (EG) nr

1. ett

lufttrafikföretag som

inte

261/2004,

 

 

lämnar

information enligt

artikel

– artikel 11 i förordning (EG) nr

14 i förordning (EG) nr 261/2004,

2111/2005,

 

 

2. ett

 

lufttrafikföretag,

 

en

– artikel 4 i förordning (EG) nr

researrangör eller en biljettför-

1107/2006, eller

 

 

säljare

som inte

lämnar

in-

– artikel 23.1 i förordning (EG)

formation till passagerare enligt artikel 11 i förordning (EG) nr 2111/2005, och

3. ett lufttrafikföretag, dess agent eller en researrangör som inte lämnar information enligt artikel 4 i förordning (EG) nr 1107/2006.

Talan om åläggande enligt första stycket väcks vid Mark- nadsdomstolen. En sådan talan får väckas av

1.Konsumentombudsmannen,

2.en näringsidkare som har ingått ett avtal som rör transport

med lufttrafikföretaget, dess agent, researrangören eller biljett- försäljaren, och

3. en sammanslutning av konsumenter eller näringsidkare.

I ett sådant mål gäller i övrigt de bestämmelser i marknads- föringslagen (2008:486) som är tillämpliga i mål om åläggande att lämna information enligt 24 § den lagen.

nr 1008/2008

ska marknadsföringslagen (2008:486) tillämpas, med undantag av bestämmelserna i 29– 36 §§ om marknadsstör- ningsavgift. Sådan information ska anses vara väsentlig enligt 10 § tredje stycket den lagen.

Ett lufttrafikföretag, dess agent eller en researrangör som vägrar personer med funktionshinder eller nedsatt rörlighet transport i strid med artiklarna 3 och 4 i förord- ningen (EG) nr 1107/2006 får

åläggas att vid vite erbjuda transporterna i fråga.

Talan om åläggande enligt första stycket väcks vid Mark- nadsdomstolen av Konsument- ombudsmannen.

16 §

Ett lufttrafikföretag, dess agent eller en researrangör som vägrar personer med funktionsnedsättning eller nedsatt rörlighet transport i strid med artiklarna 3 och 4 i förordning (EG) nr 1107/2006 får vid vite åläggas att erbjuda transporterna i fråga.

Ett lufttrafikföretag, dess agent eller en researrangör som lämnar prisinformation på ett diskriminerande sätt i strid med artikel 23.2 i förordning (EG) nr 1008/2008 får vid vite förbjudas att göra detta.

Talan om åläggande enligt första stycket och förbud enligt andra stycket väcks vid Mark- nadsdomstolen av Konsument- ombudsmannen.

Bilaga 6

143

Bilaga 6

 

17 §

I ett fall som inte är av större

I fall som inte är av större vikt

får

Konsumentombuds-mannen

vikt

får

Konsument-

meddela föreläggande om

sådant

ombudsmannen

meddela före-

åläggande som avses i 15 §.

 

läggande

om

sådant åläggande

eller förbud som avses i 16 §.

För ett föreläggande enligt första stycket gäller vad som sägs i 28 § marknadsföringslagen (2008:486).

Denna lag träder i kraft den 1 juli 2014.

144

Förteckning över remissinstanser (promemorian)

Prop. 2013/14:239

 

 

 

 

 

 

Bilaga 7

Efter remiss har yttranden över promemorian lämnats av Svea hovrätt,

 

Stockholms tingsrätt, Marknadsdomstolen, Domstolsverket, Myndig-

 

heten för handikappolitisk samordning, Juridiska fakulteten vid Uppsala

 

universitet, Lunds tekniska högskola, Boverket, Trafikverket, Trafik-

 

analys, Sjöfartsverket, Transportstyrelsen, Diskrimineringsombuds-

 

mannen,

Konsumentverket

med

Konsumentombudsmannen,

 

Konkurrensverket,

Allmänna

reklamationsnämnden,

Regelrådet,

 

Branschföreningen Tågoperatörerna Handikappförbunden, Hörsel-

 

skadades Riksförbund, Jernhusen AB, Jönköpings Länstrafik, LO,

 

Regionförbundet Södra Småland, Resenärsforum, Riksfärdtjänsten i

 

Sverige AB, Samtrafiken i Sverige AB, SJ AB, Skånetrafiken,

 

Storstockholms

lokaltrafik,

Svensk

Kollektivtrafik,

Svenska

 

Bussbranschens Riksförbund, Sveriges advokatsamfund, Sveriges

 

Kommuner och Landsting, Sveriges Redareförening, SWEREF

 

Skärgårdsredarna, Synskadades Riksförbund, TCO, Värmlandstrafik

 

samt Västtrafik.

 

 

 

 

 

Elöverkänsligas Riksförbund, Keolis Sverige AB, Lika Unika,

 

Nätverket unga för tillgänglighet (NUFT), SEKO Trafik, Svenska

 

Taxiförbundet,

Svenska

Transportarbetareförbundet,

Svenska

 

Tågkompaniet AB, Svenska Färdtjänstförening, Swebus Express AB samt Veolia Transport Sverige AB har beretts tillfälle att avge yttrande men har avstått från att yttra sig.

Yttrande har dessutom avgetts av Förbundet för ett samhälle utan rörelsehinder (DHR).

145

Prop. 2013/14:239

Bilaga 8

146

Förteckning över remissinstanser (förslag till författningstext)

Efter remiss har yttranden över förslag till författningstext lämnats av Marknadsdomstolen, Konsumentverket och Transportstyrelsen.

Lagrådsremissens lagförslag

1Förslag till lag med kompletterande bestämmelser till EU:s tåg-, fartygs- och busspassagerarförordningar

Härigenom föreskrivs följande.

Tåg-, fartygs- och busspassagerarförordningarna 1 § I denna lag finns bestämmelser som kompletterar

1.Europaparlamentets och rådets förordning (EG) nr 1371/2007 av den 23 oktober 2007 om rättigheter och skyldigheter för tågresenärer (tågpassagerarförordningen),

2.Europaparlamentets och rådets förordning (EU) nr 1177/2010 av den 24 november 2010 om passagerares rättigheter vid resor till sjöss och på inre vattenvägar och om ändring av förordning (EG) nr 2006/2004 (fartygspassagerarförordningen), och

3.Europaparlamentets och rådets förordning (EU) nr 181/2011 av den 16 februari 2011 om passagerares rättigheter vid busstransport och om ändring av förordning (EG) nr 2006/2004 (busspassagerarförordningen).

Tillsyn över att förordningarna följs

2 § Den eller de myndigheter som regeringen bestämmer utövar tillsyn över att de skyldigheter som följer av tåg-, fartygs- och busspassagerar- förordningarna fullgörs.

3 § Regeringen eller den myndighet som regeringen bestämmer får med- dela föreskrifter om avgifter för tillsyn enligt tåg-, fartygs- och buss- passagerarförordningarna.

Sanktioner

4 § Skyldighet att lämna information föreskrivs för järnvägsföretag, biljettutfärdare, stationsförvaltare, researrangörer, transportörer, rese- byråer, terminaloperatörer och hamnmyndigheter i

1.artiklarna 4, 8, 9.5, 18.1, 20, 22.3, 28.2 och 29 i tågpassagerarför- ordningen,

2.artiklarna 8.5, 9.2–9.4, 10, 12.3, 13.3, 16, 22 och 23 i fartygs- passagerarförordningen, och

3.artiklarna 10.2, 10.5, 11.2–11.5, 13.2, 14.5, 20, 24 och 25 i buss- passagerarförordningen.

Om information inte lämnas enligt någon av de bestämmelser som anges i första stycket, ska marknadsföringslagen (2008:486) tillämpas, med undantag av 29–36 §§ om marknadsstörningsavgift. Sådan informa- tion ska anses vara väsentlig enligt 10 § tredje stycket den lagen.

Prop. 2013/14:239

Bilaga 9

147

Prop. 2013/14:239 5 § Andra skyldigheter än att lämna information föreskrivs för järnvägs- Bilaga 9 företag, biljettutfärdare, stationsförvaltare, researrangörer, transportörer,

resebyråer och terminaloperatörer i

1.artiklarna 9.1–9.4, 18.3–18.5, 19, 22.1, 23, 24, 27 och 28 i tågpassagerarförordningen,

2.artiklarna 4, 7–8.4, 9.1, 10–13.2, 15.4 och 24 i fartygspassagerar- förordningen, och

3.artiklarna 4, 8, 9, 10.1, 10.3, 10.4, 11.1, 13–15, 17.3, 26 och 27 i busspassagerarförordningen.

Den som inte fullgör en sådan annan skyldighet som avses i första stycket får åläggas att göra det. Åläggandet får förenas med vite. En talan om ett sådant åläggande väcks vid Marknadsdomstolen av Konsument- ombudsmannen.

I samband med ålägganden enligt andra stycket tillämpas 42–45 §§ marknadsföringslagen (2008:486) och det som i övrigt gäller enligt den lagen vid tillämpning av de bestämmelserna.

6 § I ett fall som inte är av större vikt får Konsumentombudsmannen meddela ett föreläggande om ett sådant åläggande som avses i 5 §. Bestämmelserna i 28 § marknadsföringslagen (2008:486) ska då tillämpas.

7 § Den myndighet som utövar tillsyn över fullgörandet av de skyld- igheter som anges i artiklarna 10.1, 10.2, 10.4, 21 och 26 i tågpassagerar- förordningen, artikel 14 i fartygspassagerarförordningen och artikel 16.1 i busspassagerarförordningen får meddela de förelägganden som behövs för att bestämmelserna ska följas.

Ett sådant föreläggande får förenas med vite.

Befogenhet att utse bussterminaler

8 § Regeringen eller, efter regeringens bestämmande, en statlig myndig- het eller de regionala kollektivtrafikmyndigheter som avses i lagen (2010:1065) om kollektivtrafik får i det enskilda fallet besluta om att utse bussterminaler där assistans för personer med funktionsnedsättning eller nedsatt rörlighet ska tillhandahållas i enlighet med busspassagerarför- ordningen.

Överklagande

9 § Tillsynsmyndighetens beslut om föreläggande enligt 7 § får över- klagas till allmän förvaltningsdomstol. Detsamma gäller ett beslut av en statlig myndighet eller en regional kollektivtrafikmyndighet om att utse en bussterminal enligt 8 §.

Prövningstillstånd krävs vid överklagande till kammarrätten.

Denna lag träder i kraft den 1 januari 2015.

148

2Förslag till lag om ändring i lagen (1970:417) om marknadsdomstol m.m.

Härigenom föreskrivs att 1 § lagen (1970:417) om marknadsdomstol m.m.1 ska ha följande lydelse.

Prop. 2013/14:239

Bilaga 9

Nuvarande lydelse

Föreslagen lydelse

1 §2 Marknadsdomstolen handlägger mål och ärenden enligt

1.konkurrenslagen (2008:579),

2.marknadsföringslagen (2008:486),

3.lagen (1994:1512) om avtalsvillkor i konsumentförhållanden,

4.lagen (1984:292) om avtalsvillkor mellan näringsidkare,

5.lagen (2000:1175) om talerätt för vissa utländska konsument- myndigheter och konsumentorganisationer,

6.försäkringsavtalslagen (2005:104),

7.lagen (2005:590) om insyn i vissa finansiella förbindelser m.m.,

8.lagen (2006:484) om franchisegivares informationsskyldighet,

9.lagen (2010:510) om lufttransporter,

10.lagen (1986:436) om näringsförbud, och

11.lagen (2010:1350) om upp- giftsskyldighet i fråga om mark- nads- och konkurrensförhållanden.

Bestämmelserna i 14–22 §§ tillämpas inte i mål eller ärenden enligt konkurrenslagen, marknads- föringslagen, försäkringsavtals- lagen, lagen om insyn i vissa finansiella förbindelser m.m., lagen om franchisegivares informationsskyldighet, lagen om lufttransporter, lagen om näringsförbud eller lagen om uppgiftsskyldighet i fråga om marknads- och konkurrensförhåll- anden. I mål enligt mark- nadsföringslagen, försäkrings- avtalslagen eller lagen om franchisegivares informations-

10.lagen (1986:436) om näringsförbud,

11.lagen (2010:1350) om uppgiftsskyldighet i fråga om marknads- och konkurrens- förhållanden, och

12.lagen (2014:000) med

kompletterande bestämmelser till EU:s tåg-, fartygs- och buss- passagerarförordningar.

Bestämmelserna i 14–22 §§ tillämpas inte i mål eller ärenden enligt konkurrenslagen, marknads- föringslagen, försäkringsavtals- lagen, lagen om insyn i vissa finansiella förbindelser m.m., lagen om franchisegivares informationsskyldighet, 13 eller 15 § lagen om lufttransporter, lagen om näringsförbud, lagen om uppgiftsskyldighet i fråga om marknads- och konkurrens- förhållanden eller 4 § lagen med kompletterande bestämmelser till EU:s tåg-, fartygs- och buss- passagerarförordningar. I mål

1Lagen omtryckt 1984:294.

2Senaste lydelse 2010:1352.

149

Prop. 2013/14:239

skyldighet tillämpas

inte heller

enligt

marknadsföringslagen,

Bilaga 9

13 a §. I stället gäller

rättegångs-

försäkringsavtalslagen

eller

lagen

 

reglerna i dessa lagar.

 

om franchisegivares informations-

 

 

 

skyldighet

tillämpas

inte

heller

 

 

 

13 a §. I stället gäller

rättegångs-

 

 

 

reglerna i dessa lagar.

 

 

Denna lag träder i kraft den 1 januari 2015.

150

3Förslag till lag om ändring i lagen (1992:1672) om paketresor

Härigenom föreskrivs att 18 § lagen (1992:1672) om paketresor ska ha följande lydelse.

Prop. 2013/14:239

Bilaga 9

Nuvarande lydelse

 

 

 

Föreslagen lydelse

 

 

 

 

 

 

 

 

18 §1

 

 

 

 

 

Skador

som

omfattas

av

Vissa skador, som omfattas av

bestämmelserna

i

sjölagen

andra bestämmelser, ersätts enligt

(1994:1009),

rådets

förordning

de bestämmelserna i stället för

(EG) nr 2027/97 av den 9 oktober

enligt denna lag. Detta gäller

1997 om lufttrafikföretags skade-

skador som omfattas av bestämm-

ståndsansvar avseende

lufttrans-

elserna i

 

 

 

 

port av passagerare och deras

1. sjölagen (1994:1009),

 

bagage,

lagen

(2010:510)

om

2. rådets

förordning

(EG)

nr

lufttransporter, järnvägstrafiklagen

2027/97 av den 9 oktober 1997 om

(1985:192) eller lagen (1985:193)

lufttrafikföretags

skadestånds-