Regeringens proposition 2011/12:77

Tredje inremarknadspaketet för el och naturgas

Prop.

– vissa genomförandeåtgärder

2011/12:77

Regeringen överlämnar denna proposition till riksdagen.

Stockholm den 1 mars 2012

Fredrik Reinfeldt

Lena Ek

(Näringsdepartementet)

Propositionens huvudsakliga innehåll

I propositionen föreslås ändringar i ellagen (1997:857) och naturgaslagen

 

(2005:403). Syftet med förslagen är att genomföra delar av EU:s s.k.

 

tredje inremarknadspaket för el och naturgas.

 

I propositionen föreslås att vissa samriskföretag på el- respektive

 

naturgasmarknaden ska vara skyldiga att upprätta en övervakningsplan.

 

Det föreslås att ett elnätsföretag inte ska få ingå avtal om tillträde till

 

en ledning eller ett ledningsnät förrän de metoder som har använts för att

 

utforma avtalsvillkoren, med undantag för avgifter för överföring av el

 

och för anslutning, har prövats av nätmyndigheten. Vidare ska den som

 

innehar en förgasningsanläggning (LNG-anläggning) inte få börja

 

tillämpa sin tariff för tillträde förrän de metoder som har använts för att

 

utforma tariffen har godkänts av tillsynsmyndigheten.

 

I propositionen föreslås vidare att det ska införas tydligare krav på

 

åtskillnad av naturgaslagring i förhållande till produktion av eller handel

 

med naturgas.

 

På naturgasområdet föreslås också bestämmelser som ska säkerställa

 

att kommersiellt känsliga uppgifter inom en transmissions-, lagrings-

 

eller förgasningsverksamhet inte görs tillgängliga för delar av företaget

 

eller koncernen som bedriver annan verksamhet. Regeringen eller

 

tillsynsmyndigheten ska samtidigt få meddela föreskrifter om skyldighet

 

för sådana företag att offentliggöra information som har betydelse för

 

naturgasmarknadens funktion.

 

Bestämmelserna om undantag för ny naturgasinfrastruktur föreslås få

 

ett delvis annat innehåll.

 

Slutligen föreslås att regeringen eller den myndighet som regeringen

 

bestämmer ska få meddela föreskrifter om skyldighet för el- och natur-

1

 

gasleverantörer att dokumentera och bevara uppgifter om leveransavtal och derivatinstrument och på begäran lämna sådana uppgifter till en svensk myndighet eller Europeiska kommissionen.

Lagändringarna föreslås träda i kraft den 1 juli 2012.

Prop. 2011/12:77

2

Innehållsförteckning

Prop. 2011/12:77

1

Förslag till riksdagsbeslut ................................................................

5

2

Lagtext

.............................................................................................

6

 

2.1 ...............

Förslag till lag om ändring i ellagen (1997:857)

6

2.2Förslag till lag om ändring i naturgaslagen

 

 

(2005:403) .........................................................................

9

3

Ärendet och dess beredning ...........................................................

18

4

Övervakningsplan för samriskföretag ............................................

19

 

4.1

Direktivens krav ..............................................................

19

 

4.2

Samriskföretag på elområdet...........................................

20

 

4.3

Samriskföretag på naturgasområdet ................................

22

5

Villkor för tillträde till infrastruktur...............................................

23

 

5.1

Tillträde till elnät.............................................................

23

 

5.2

Tillträde till förgasningsanläggning.................................

26

6

Åtskillnad av naturgaslagring ........................................................

28

 

6.1

Tydligare krav på åtskillnad av lagringsverksamhet .......

28

 

6.2

Yrkesmässiga intressen ...................................................

29

 

6.3

Faktisk beslutanderätt......................................................

30

 

6.4

Övervakningsplan............................................................

31

 

6.5

Undantag

.........................................................................

31

7

Konfidentiell behandling av uppgifter ...........................................

32

 

7.1

Gasmarknadsdirektivets krav ..........................................

32

 

7.2

Förbud mot ..........................................att röja uppgifter

33

 

7.3

Offentliggörande .....................................av information

34

8

Ny naturgasinfrastruktur ................................................................

35

 

8.1

Bakgrund .........................................................................

 

35

 

8.2

Nya krav ....................................för att bevilja undantag

35

 

 

8.2.1 ..................................

Undantagets omfattning

35

 

 

8.2.2

Villkor för förvaltning och tilldelning av

 

 

 

..........................................................

kapacitet

37

 

8.3

Prövningsmyndighet........................................................

39

 

8.4

Behovet av ................................övergångsbestämmelser

41

9

Skyldighet att bevara ..................................................information

42

10

Ikraftträdande.................................................................................

 

46

11

Konsekvensanalys..........................................................................

 

46

 

11.1

Inledning..........................................................................

 

46

 

11.2

Företagen ...............................................på elmarknaden

46

 

11.3

Naturgasföretagen ...........................................................

47

 

11.4

Energimarknadsinspektionen ..........................................

49

 

11.5

De allmänna .............................förvaltningsdomstolarna

50

12

Författningskommentar..................................................................

52

 

12.1

Förslaget ..........till lag om ändring i ellagen (1997:857)

52

12.2Förslaget till lag om ändring i naturgaslagen

(2005:403) .......................................................................

55

 

3

Bilaga 1 Europaparlamentets och rådets direktiv 2009/72/EG av

Prop. 2011/12:77

 

den 13 juli 2009....................................................................

66

Bilaga 2 Europaparlamentets och rådets direktiv 2009/73/EG av

 

 

den 13 juli 2009..................................................................

105

Bilaga 3 Sammanfattning av NELGA:s betänkande Tredje inre

 

 

marknadspaketet för el och naturgas (SOU 2010:30).........

148

Bilaga 4 Nya el- och gasmarknadsutredningens lagförslag ..............

156

Bilaga 5 Förteckning över remissinstanserna vid

 

 

remissbehandlingen av betänkandet Tredje inre

 

 

marknadspaketet för el och naturgas (SOU 2010:30).........

183

Bilaga 6

Sammanfattning av promemorian Tredje

 

 

inremarknadspaketet för el och naturgas – vissa

 

 

genomförandeåtgärder........................................................

184

Bilaga 7

Promemorians lagförslag....................................................

185

Bilaga 8 Förteckning över remissinstanserna för promemorian

 

 

Tredje inremarknadspaketet för el och naturgas – vissa

 

 

genomförandeåtgärder........................................................

196

Bilaga 9

Lagrådsremissens lagförslag...............................................

197

Bilaga 10

Lagrådets yttrande ..............................................................

208

Utdrag ur protokoll vid regeringssammanträde den 1 mars 2012.........

214

Rättsdatablad ........................................................................................

215

4

1 Förslag till riksdagsbeslut

Regeringen föreslår att riksdagen antar regeringens förslag till

1.lag om ändring i ellagen (1997:857),

2.lag om ändring i naturgaslagen (2005:403).

Prop. 2011/12:77

5

2

Lagtext

Prop. 2011/12:77

2.1Förslag till lag om ändring i ellagen (1997:857)

Härigenom föreskrivs1 i fråga om ellagen (1997:857) dels att 13 kap. 5 § ska ha följande lydelse,

dels att det i lagen ska införas tre nya paragrafer, 3 kap. 17 b §, 4 kap. 1 a § och 12 kap. 15 §, samt närmast före 12 kap. 15 § en ny rubrik av följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

3 kap.

17 b §

Ett samriskföretag ska upprätta och genomföra en övervaknings- plan, om

1.företaget har bildats för att genomföra ett samarbete som syftar till att integrera marknader för el i Norden och Europeiska unionen, och

2.det bland de företag som har bildat samriskföretaget finns nät- företag som ingår i samma koncern som företag som, utan att vara produktionsföretag som avses

i1 i §, bedriver produktion av eller handel med el.

Av övervakningsplanen ska det framgå vilka åtgärder som före- taget ska vidta för att förhindra diskriminerande och konkurrens- begränsande beteende gentemot övriga aktörer på elmarknaden. I planen ska särskilt anges de sär- skilda skyldigheter som företagets anställda har för att förhindra detta.

Övervakningsplanen ska god- kännas av byrån för samarbete mellan energitillsynsmyndigheter. Planen ska ges in till byrån för prövning av sådant godkännande.

1 Jfr Europaparlamentets och rådets direktiv 2009/72/EG av den 13 juli 2009 om gemensamma regler för den inre marknaden för el och om upphävande av direktiv 2003/54/EG (EUT L 211, 14.8.2009, s. 55, Celex 32009L0072).

6

Prop. 2011/12:77

4 kap.

1 a §

En nätkoncessionshavare får inte ingå avtal om tillträde till en ledning eller ett ledningsnät förrän de metoder som har använts för att utforma avtalsvillkoren har prövats av nätmyndigheten. Nätmyndigheten ska godkänna metoderna, om de kan antas leda till att avtalen uppfyller de krav som anges i 1 § första stycket. Prövningen ska dock inte omfatta metoder för att utforma avgifter för överföring av el och för anslutning.

Om nätmyndigheten inte god- känner de metoder som föreslås i en ansökan, ska myndigheten i beslutet ange de metoder som i stället ska tillämpas.

Beslut enligt första och andra styckena gäller omedelbart. Nät- myndigheten ska delge beslutet enligt 49 § första stycket 1 och andra stycket delgivningslagen (2010:1932).

12 kap.

Bevarande av information

15 §

Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om skyldighet för elleverantörer att dokumentera och bevara uppgifter om leverans- avtal, derivatinstrument och transaktioner som gäller sådana avtal eller instrument samt att på begäran lämna sådana uppgifter till en svensk myndighet eller Europeiska kommissionen.

7

 

 

 

 

13 kap.

 

 

 

Prop. 2011/12:77

 

 

 

 

5 §2

 

 

 

 

Beslut av nätmyndigheten enligt

Beslut av nätmyndigheten enligt

2 kap. 18–20 §§, 3 kap. 3, 6–8,

2 kap. 18–20 §§, 3 kap. 3, 6–8,

9 b, 11, 14 och 15 §§, 4 kap. 6, 7

9 b, 11, 14 och 15 §§, 4 kap. 1 a,

och 10 §§, 5 kap. 3, 11–13, 15–17,

6, 7 och 10 §§, 5 kap. 3, 11–13,

26 och 27 §§, 8 kap. 4 a § samt

15–17, 26 och 27 §§, 8 kap. 4 a §

12 kap. 8 och 11 §§, beslut av en

samt 12 kap. 8 och 11 §§, beslut

tillsynsmyndighet

enligt

12

kap.

av en

tillsynsmyndighet

enligt

2–4 §§ samt beslut av den system-

12 kap. 2–4 §§ samt beslut av den

ansvariga myndigheten om ersätt-

systemansvariga myndigheten om

ning till den som enligt 8 kap. 2 §

ersättning

till

den som

enligt

beordrats

öka

eller

minska

8 kap.

2

§ beordrats öka

eller

produktionen av el får överklagas

minska produktionen av el får

hos allmän

förvaltningsdomstol.

överklagas till allmän förvalt-

Prövningstillstånd

krävs

vid

ningsdomstol.

Prövningstillstånd

överklagande till kammarrätten.

krävs

vid

överklagande

till

Regeringen får meddela före-

kammarrätt.

meddelar

 

Regeringen

före-

skrifter om överklagande av andra

skrifter om överklagande till rege-

beslut enligt denna lag eller enligt

ringen av andra beslut enligt

föreskrifter

som

meddelats

med

denna lag eller enligt föreskrifter

stöd av lagen.

 

 

 

som har meddelats med stöd av

 

 

 

 

 

lagen.

 

 

 

 

1.Denna lag träder i kraft den 1 juli 2012.

2.De nya bestämmelserna i 4 kap. 1 a § tillämpas dock inte på

a)sådana avtal om tillträde till en ledning eller ett ledningsnät som en nätkoncessionshavare ingår före den 1 januari 2013, eller

b)avtal som nätkoncessionshavaren ingår under tiden från det att en ansökan om metodprövning har lämnats in till nätmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan har lämnats in före utgången av augusti 2012.

2 Senaste lydelse 2009:892.

8

2.2

Förslag till lag om ändring i naturgaslagen (2005:403) Prop. 2011/12:77

Härigenom föreskrivs1 i fråga om naturgaslagen (2005:403)2 dels att 9 kap. 5 och 6 §§ ska upphöra att gälla,

dels att rubriken närmast före 9 kap. 5 § ska utgå,

dels att 1 kap. 7 a §, 4 kap. 2 §, 6 kap. 5 § och 9 kap. 1 och 4 §§ ska ha följande lydelse,

dels att det i lagen ska införas fjorton nya paragrafer, 1 kap. 6 a §, 3 kap. 2 f, 10 a och 12 §§, 4 kap. 2 a–2 d §§ och 7–10 §§, 9 kap. 3 a § och 10 kap. 13 §, samt närmast före 3 kap. 12 §, 4 kap. 7, 9 och 10 §§ och 10 kap. 13 § nya rubriker av följande lydelse.

Nuvarande lydelse

Föreslagen lydelse

1 kap.

6 a §

Med transmission avses i denna lag överföring av naturgas i en högtrycksledning eller ett nät som i huvudsak består av högtrycks- ledningar med undantag för hög- trycksledning som huvudsakligen används i samband med lokal distribution av naturgas.

7 a §3

Med transmissionsnätsoperatör

Med transmissionsnätsoperatör

avses i denna lag den som bedriver

avses i denna lag den som bedriver

överföring av naturgas i en hög-

transmission.

trycksledning eller ett nät som i

 

huvudsak består av högtrycks-

 

ledningar med undantag för hög-

 

trycksledning som huvudsakligen

 

används i samband med lokal

 

distribution av naturgas.

 

1Jfr Europaparlamentets och rådets direktiv 2009/73/EG av den 13 juli 2009 om gemensamma regler för den inre marknaden för naturgas och om upphävande av direktiv 2003/55/EG (EUT L 211, 14.8.2009, s. 94, Celex 32009L0073).

2Senaste lydelse av 9 kap. 5 § 2011:713.

3Senaste lydelse 2011:713.

9

3 kap.

2 f §

Om en transmissionsnäts- operatör bedriver även annan verksamhet än transmission, ska operatören säkerställa att kommersiellt känsliga uppgifter om transmissionen inte görs till- gängliga för de delar av företaget som bedriver annan verksamhet.

Om en transmissionsnäts- operatör ingår i en koncern, ska operatören säkerställa att kommersiellt känsliga uppgifter om transmissionen inte görs tillgängliga för företag i koncernen som bedriver annan verksamhet.

Första och andra styckena hindrar inte att kommersiellt känsliga uppgifter om trans- mission görs tillgängliga för företag eller delar av företag som bedriver annan verksamhet, om det är nödvändigt för att genom- föra en affärstransaktion.

10 a §

Ett samriskföretag ska upprätta och genomföra en övervaknings- plan, om

1.företaget har bildats för att genomföra ett samarbete som syftar till att integrera marknader för naturgas i Norden och Euro- peiska unionen, och

2.det bland de företag som har bildat samriskföretaget finns en transmissionsnätsoperatör som ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas.

Av övervakningsplanen ska det framgå vilka åtgärder som före- taget ska vidta för att förhindra diskriminerande och konkurrens- begränsande beteende gentemot övriga aktörer på naturgas- marknaden. I planen ska dessutom anges de särskilda skyldigheter

Prop. 2011/12:77

10

som företagets anställda har för Prop. 2011/12:77 att förhindra detta.

Övervakningsplanen ska god- kännas av byrån för samarbete mellan energitillsynsmyndigheter. Planen ska ges in till byrån för prövning av sådant godkännande.

Offentliggörande av information

12 §

Regeringen eller, efter rege- ringens bemyndigande, tillsyns- myndigheten får meddela före- skrifter om skyldighet för en transmissionsnätsoperatör att offentliggöra information som har betydelse för naturgasmarknadens funktion.

4kap.

2 §

Ett företag som innehar en lag-

Ett företag som innehar en lag-

ringsanläggning eller en förgas-

ringsanläggning

får inte

bedriva

ningsanläggning får

inte bedriva

produktion av eller handel med

handel med naturgas.

 

naturgas. Om ett sådant företag

 

 

ingår i en koncern, ska dess orga-

 

 

nisation

och beslutsordning

vara

 

 

skild från företag som bedriver

 

 

produktion av eller handel med

 

 

naturgas.

 

 

 

I ett sådant företag får inte en

En

styrelseledamot,

 

verk-

styrelseledamot,

verkställande

ställande direktör eller firma-

direktör eller firmatecknare sam-

tecknare i ett företag som innehar

tidigt vara styrelseledamot, verk-

en lagringsanläggning

får

inte

ställande direktör eller firma-

samtidigt vara

styrelseledamot,

tecknare i ett företag som bedriver

verkställande direktör eller firma-

handel med naturgas.

 

tecknare i ett företag som bedriver

 

 

produktion av eller handel med

 

 

naturgas.

 

 

 

 

 

 

2 a §

 

 

 

 

 

 

Ett företag som innehar en lag-

 

 

ringsanläggning

och

ingår i

 

 

samma koncern som ett företag

 

 

som bedriver produktion av eller

handel med naturgas får inte bevilja anställda i ledande ställ- ning löner eller andra förmåner

som grundar sig på resultatet i de

11

delar av koncernen som bedriver

Prop. 2011/12:77

sådan produktion eller handel.

 

2 b §

 

 

 

 

 

 

 

Ett företag som innehar en lag-

 

ringsanläggning och ingår i en

 

koncern där ett annat företag

 

bedriver

produktion

av

eller

 

handel med naturgas ska, till-

 

sammans

med

sitt

moderföretag,

 

se till att det har en i förhållande

 

till övriga företag i koncernen

 

faktisk och självständig beslu-

 

tanderätt när det gäller de till-

 

gångar som behövs för att trygga

 

drift, underhåll och utbyggnad av

 

anläggningen.

 

 

 

 

 

 

Första stycket hindrar inte att

 

moderföretaget

har

sådan

insyn

 

och utövar sådan styrning av

 

anläggningsföretaget som

krävs

 

för att säkerställa en rimlig

 

avkastning på

de

investeringar

 

som gjorts i anläggningsföretaget.

 

Moderföretaget får dock inte ge

 

instruktioner åt

anläggningsföre-

 

taget om företagets löpande för-

 

valtning eller beslut att bygga

 

eller modernisera en lagrings-

 

anläggning, om inte instruk-

 

tionerna

avser

åtgärder

eller

 

beslut som går utöver de eko-

 

nomiska ramar som fastställts av

 

anläggningsföretagets

bolags-

 

stämma eller motsvarande organ.

 

2 c §

 

 

 

 

 

 

 

Om ett företag som innehar en

 

lagringsanläggning bedriver även

 

annan verksamhet än lagring av

 

naturgas, ska företaget säkerställa

 

att kommersiellt känsliga uppgifter

 

om lagringen inte görs tillgäng-

 

liga för de delar av företaget som

 

bedriver annan verksamhet.

 

 

Ett företag som innehar en lag-

 

ringsanläggning och ingår i en

 

koncern

ska

 

säkerställa

att

 

kommersiellt

känsliga

uppgifter

 

om lagringen

inte

görs

tillgäng-

12

liga för

företag

i

koncernen som Prop. 2011/12:77

bedriver annan verksamhet.

Första

och

andra

styckena

hindrar

inte

att

kommersiellt

känsliga

uppgifter

om

lagringen

görs tillgängliga för företag eller delar av företag som bedriver annan verksamhet, om det är nödvändigt för att genomföra en affärstransaktion.

2 d §

Bestämmelserna i 2 c § om företag som innehar en lagrings- anläggning och om lagring av naturgas gäller även företag som innehar en förgasningsanläggning och drift av en sådan anläggning.

Övervakningsplan

7 §

Ett företag som innehar en lag- ringsanläggning och ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas ska upprätta en övervakningsplan och se till att planen följs.

Av övervakningsplanen ska det framgå vilka åtgärder som före- taget ska vidta för att motverka diskriminerande beteende gente- mot övriga aktörer på naturgas- marknaden. I planen ska anges de särskilda skyldigheter som före- tagets anställda har för att mot- verka detta.

Regeringen eller, efter rege- ringens bemyndigande, tillsyns- myndigheten får meddela ytter- ligare föreskrifter om innehållet i övervakningsplanen.

8 §

Den som är skyldig att upprätta en övervakningsplan enligt 7 § ska årligen upprätta en rapport över de åtgärder som vidtagits.

Rapporten ska ges in till tillsyns-

13

 

 

 

myndigheten och i samband med Prop. 2011/12:77

 

 

 

detta offentliggöras av ingivaren.

 

 

 

Regeringen eller, efter rege-

 

 

 

ringens

bemyndigande,

tillsyns-

 

 

 

myndigheten får meddela ytter-

 

 

 

ligare föreskrifter om offentlig-

 

 

 

görandet av den årliga rapporten.

 

 

 

Undantag från kraven på inne-

 

 

 

havare av lagringsanläggningar

 

 

 

9 §

 

 

 

 

 

 

 

 

Regeringen eller, efter rege-

 

 

 

ringens

bemyndigande,

tillsyns-

 

 

 

myndigheten får meddela före-

 

 

 

skrifter om undantag från de

 

 

 

skyldigheter som följer av 2–2 b, 7

 

 

 

och 8 §§.

 

 

 

 

 

 

 

 

Offentliggörande av information

 

 

 

10 §

 

 

 

 

 

 

 

 

Regeringen eller, efter rege-

 

 

 

ringens

bemyndigande,

tillsyns-

 

 

 

myndigheten får meddela före-

 

 

 

skrifter om skyldighet för företag

 

 

 

som innehar en lagrings- eller

 

 

 

förgasningsanläggning

att offent-

 

 

 

liggöra

information

som

har

 

 

 

betydelse för naturgasmarknadens

 

 

 

funktion.

 

 

 

 

 

 

 

6 kap.

 

 

 

 

 

 

 

5 §4

 

 

 

 

 

Den som bedriver överföring av

Den som bedriver överföring av

naturgas får inte börja tillämpa sin

naturgas eller innehar en förgas-

avgift och övriga villkor för sådan

ningsanläggning får

inte

börja

anslutning som avses i 3 kap. 5 §

tillämpa sin avgift och övriga

eller sin överföringstariff förrän de

villkor för sådan anslutning som

metoder som har använts för att

avses i 3 kap. 5 § eller sin tariff för

utforma avgiften eller tariffen har

överföring eller tillträde förrän de

godkänts

av tillsynsmyndigheten.

metoder som har använts för att

Godkännande

ska lämnas, om

utforma avgiften eller tariffen har

metoderna kan antas leda till att

godkänts

av tillsynsmyndigheten.

avgiften

eller

tariffen uppfyller

Godkännande

ska lämnas,

om

kraven på att den ska vara objektiv

metoderna kan antas leda till att

och icke-diskriminerande.

avgiften

eller

tariffen

 

uppfyller

4 Senaste lydelse 2010:1976.

14

 

 

 

kraven på att den ska vara objektiv Prop. 2011/12:77

 

 

 

och icke-diskriminerande.

 

Om tillsynsmyndigheten inte godkänner de metoder som avses med en

ansökan, ska myndigheten i beslutet ange de metoder som i stället ska

tillämpas.

 

 

 

 

 

 

Beslut enligt första och andra styckena gäller omedelbart. Tillsyns-

myndigheten ska delge sådana beslut enligt 49 § första stycket 1 och

andra stycket delgivningslagen (2010:1932).

 

 

 

 

9 kap.

 

 

 

 

 

1 §5

 

 

 

Den som har ansökt om

Den som har ansökt om

koncession som avser byggande av

koncession som avser byggande av

en naturgasledning, en lagrings-

en naturgasledning, en lagrings-

anläggning eller en förgasnings-

anläggning eller en förgasnings-

anläggning får, om den berörda

anläggning får, om den berörda

ledningen eller anläggningen är av

ledningen eller anläggningen är av

större omfattning, beviljas undan-

större omfattning, beviljas undan-

tag från

skyldigheterna enligt

tag

från

skyldigheterna

enligt

3 kap. 2–2 d, 5,

6 och 8–10 §§,

3 kap. 2–2 d, 5 och 6 §§, 4 kap. 5

4 kap. 2, 5

och

6 §§ samt 6 och

och 6 §§, 6 kap. 1–3, 4 och 5 §§

7 kap.

 

 

och 7 kap. 5 § samt föreskrifter

 

 

 

som

har

meddelats med

stöd av

6 kap. 3 a §.

Detsamma gäller den som har ansökt om koncession som avser ett väsentligt utökande av kapaciteten i en befintlig sådan ledning eller

anläggning.

 

Ett beslut om undantag enligt

Ett beslut om undantag får avse

andra stycket får endast avse den

hela eller en del av kapaciteten i

utökade kapaciteten i den berörda

den berörda ledningen eller

ledningen eller anläggningen.

anläggningen.

3 a §

Innan ett beslut om undantag meddelas ska villkor fastställas för hanteringen av kapacitet.

Villkoren ska säkerställa att

1.alla potentiella användare av ledningen eller anläggningen får möjlighet att anmäla sitt intresse för att teckna avtal om viss kapacitet innan kapaciteten för- delas, och

2.den kapacitet som inte används görs till föremål för handel på en marknad och att den som har tecknat avtal om kapacitet

5 Senaste lydelse 2011:713.

15

har möjlighet att bedriva sådan handel.

Den som har ansökt om undan- tag ska ha fördelat kapaciteten inom sex månader efter det att villkor har fastställts enligt första och andra styckena. Ett undantag får inte beviljas innan kapaciteten har fördelats.

4 §

Ärenden om undantag enligt 1 § prövas av regeringen efter ansökan.

Tillsynsmyndigheten skall utreda ärenden som anges i första stycket och därefter, med eget yttrande, överlämna ärendet till regeringens prövning. Tillsyns- myndigheten skall därvid offent- liggöra sitt yttrande.

Regeringen meddelar före- skrifter om i vilka fall frågor enligt detta kapitel prövas av byrån för samarbete mellan energitillsyns- myndigheter och i vilka fall de prövas av tillsynsmyndigheten.

10 kap.

Bevarande av information

13 §

Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om skyldighet för naturgasleverantörer att dokumentera och bevara uppgifter om leveransavtal, derivat- instrument och transaktioner som gäller sådana avtal eller instrument samt att på begäran lämna sådana uppgifter till en svensk myndighet eller Europeiska kommissionen.

1.Denna lag träder i kraft den 1 juli 2012.

2.De nya bestämmelserna i 6 kap. 5 § första stycket tillämpas dock inte på

a) sådana tariffer för tillträde till en förgasningsanläggning som gäller för tiden före det räkenskapsår som börjar den 1 januari 2013 eller närmast därefter, eller

Prop. 2011/12:77

16

b) sådan tariff för tillträde till en förgasningsanläggning som anlägg- ningens innehavare tillämpar från det att en ansökan om godkännande har lämnats in till tillsynsmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan har lämnats in före utgången av augusti 2012.

Prop. 2011/12:77

17

3

Ärendet och dess beredning

Prop. 2011/12:77

Den 13 juli 2009 antogs det s.k. tredje inremarknadspaketet för el och naturgas av Europaparlamentet och rådet. Paketet består av två direktiv och tre förordningar.

Direktiv 2009/72/EG om gemensamma regler för den inre marknaden för el och om upphävande av direktiv 2003/54/EG (EUT L 211, 14.8.2009, s. 55, Celex 32009L0072), i det följande elmarknadsdirek- tivet, och direktiv 2009/73/EG om gemensamma regler för den inre marknaden för naturgas och om upphävande av direktiv 2003/55/EG (EUT L 211, 14.8.2009, s. 94, Celex 32009L0073), i det följande gasmarknadsdirektivet, skulle i huvudsak genomföras i nationell lagstift- ning senast den 3 mars 2011. Direktiven återges i bilagorna 1 och 2.

Den 30 juli 2009 beslutade regeringen att tillkalla en särskild utredare (dir. 2009:21) med uppdrag bl.a. att följa det pågående arbetet inom EU med att utforma gemensamma regler för den inre marknaden för el och naturgas och lämna förslag till lagstiftning och regelverk i övrigt som krävs för att genomföra Europeiska gemenskapens reviderade el- och gasmarknadsdirektiv. Den 4 maj 2010 överlämnade Nya el- och gasmarknadsutredningen (NELGA) sitt betänkande Tredje inre marknadspaketet för el och naturgas – Fortsatt europeisk harmonisering (SOU 2010:30). En sammanfattning av betänkandet finns i bilaga 3. Utredningens lagförslag återges i bilaga 4.

Betänkandet har remissbehandlats. En förteckning över remiss- instanserna finns i bilaga 5. En sammanfattning av remissinstansernas synpunkter finns tillgänglig i Näringsdepartementet (dnr N2010/3529/E).

Regeringen har i propositionen Tredje inremarknadspaketet för el och naturgas (prop. 2010/11:70) lämnat förslag till nya lagar om certifiering av företag som bedriver överföring av el i stamledningar respektive naturgas genom högtrycksledningar. Vidare har regeringen föreslagit ett antal ändringar i ellagen (1997:857) och naturgaslagen (2005:403). Syftet med förslagen är att genomföra det tredje inremarknadspaketet.

Regeringen konstaterade i propositionen att det i en rad frågor saknades underlag för att slutligt ta ställning till om genomförande- åtgärder var nödvändiga eller för att lämna förslag till en författnings- reglering.

Mot denna bakgrund utarbetades i Regeringskansliet promemorian Tredje inre marknadspaketet för el och naturgas – vissa genomförande- åtgärder, i det följande promemorian. En sammanfattning av prome- morian finns i bilaga 6. Promemorians lagförslag återges i bilaga 7.

Promemorian har remissbehandlats. En förteckning över remiss- instanserna finns i bilaga 8. En sammanfattning av remissvaren finns tillgänglig i Näringsdepartementet (dnr N2010/3529/E).

Lagrådet

Regeringen beslutade den 26 januari 2012 att inhämta Lagrådets yttrande över de lagförslag som finns i bilaga 9. Lagrådets yttrande finns i bilaga 10.

18

Regeringen har i propositionen i huvudsak följt Lagrådets förslag. Prop. 2011/12:77 Lagrådets synpunkter behandlas i författningskommentaren. Vidare har

vissa redaktionella ändringar gjorts i förhållande till lagrådsremissen.

4 Övervakningsplan för samriskföretag

4.1Direktivens krav

Elmarknadsdirektivet

I artikel 6 i elmarknadsdirektivet finns bestämmelser om främjande av regionalt samarbete.

I artikel 6.1 behandlas medlemsstaternas och tillsynsmyndigheternas skyldighet att samarbeta med varandra i syfte att integrera sina inhemska marknader på en eller flera regionala nivåer. Artikel 6.2 handlar om uppgifter som ska fullgöras av byrån för samarbete mellan energi- tillsynsmyndigheter (Agency for the Cooperation of Energy Regulators, ACER). I artikel 6.3 stadgas att medlemsstaterna vid genomförandet av direktivet ska se till att de systemansvariga för överföringssystemen har ett eller flera regionalt integrerade system som omfattar två eller flera medlemsstater för kapacitetstilldelning och för kontroll av säkerheten för nätet. Regeringen har bedömt att några särskilda åtgärder inte är nödvändiga för att genomföra kraven i artikel 6.1–6.3 (prop. 2010/11:70

s.56).

I artikel 6.4 föreskrivs att om vertikalt integrerade systemansvariga för

överföringssystemen deltar i ett samriskföretag som inrättats i syfte att genomföra samarbetet ska samriskföretaget upprätta och genomföra en övervakningsplan med åtgärder som ska vidtas för att förhindra diskrimi- nerande och konkurrensbegränsande beteende. I övervakningsplanen ska det anges vilka specifika skyldigheter de anställda har för att uppfylla målet att utesluta diskriminering och beteenden som motverkar konkurrens. Planen ska underställas ACER:s godkännande. De över- vakningsansvariga för de vertikalt integrerade systemansvariga för över- föringssystemen ska oberoende av andra kontrollera att planen följs.

Regeringen har konstaterat att regelverket behöver kompletteras i fråga om vad som ska gälla i en situation där ett vertikalt integrerat företag ingår i ett samriskföretag som agerar på den svenska elmarknaden (a. st.).

Gasmarknadsdirektivet

I artikel 7 i gasmarknadsdirektivet finns bestämmelser om främjande av regionalt samarbete motsvarande dem som finns i artikel 6 i elmarknads- direktivet. Regeringen har konstaterat att det svenska regelverket behöver kompletteras i enlighet med artikel 7.4 för att reglera vad som ska gälla i en situation där ett vertikalt integrerat företag ingår i ett samriskföretag som agerar på den svenska naturgasmarknaden (prop. 2010/11:70 s. 144).

19

4.2

Samriskföretag på elområdet

Prop. 2011/12:77

Regeringens förslag: Ett samriskföretag ska upprätta och genomföra en övervakningsplan, om

företaget har bildats för att genomföra ett samarbete som syftar till att integrera marknader för el i Norden och Europeiska unionen, och

det bland de företag som har bildat samriskföretaget finns nätföretag som ingår i samma koncern som företag som bedriver produktion av eller handel med el, med undantag för företag som bedriver elproduktion som uteslutande är knuten till driften av stam- nätet.

Av övervakningsplanen ska det framgå vilka åtgärder som samrisk- företaget ska vidta för att förhindra diskriminerande och konkurrens- begränsande beteende gentemot övriga aktörer på elmarknaden. I planen ska särskilt anges de särskilda skyldigheter som företagets anställda har för att förhindra detta.

Övervakningsplanen ska godkännas av byrån för samarbete mellan energitillsynsmyndigheter. Planen ska ges in till byrån för prövning av sådant godkännande.

Promemorians förslag: Överensstämmer i sak med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag

Behovet av lagstiftning

I Sverige finns bestämmelser om övervakningsplan i 3 kap. 17 och 17 a §§ ellagen. Bestämmelserna, som svarar mot krav som ställs upp i artikel 26.2 d i elmarknadsdirektivet, gäller företag som bedriver nätverksamhet och som ingår i samma koncern som ett företag som bedriver produktion av eller handel med el. Något generellt krav att ett sådant samriskföretag som avses i artikel 6.4 i elmarknadsdirektivet ska upprätta en övervakningsplan finns inte i den svenska ellagstiftningen. Det är därför nödvändigt att införa regler om detta.

Företag som omfattas av skyldigheten

Skyldigheten att upprätta en övervakningsplan gäller ett samriskföretag (”joint undertaking”) som har inrättats för att genomföra ett sådant regionalt samarbete som avses i artikel 6 i elmarknadsdirektivet, dvs. ett samarbete som syftar till att integrera de nationella marknaderna för el på en eller flera regionala nivåer. Ett sådant samriskföretag kan vara systemansvarig för överföringssystem (TSO) eller oberoende system- ansvarig för överföringssystem (ISO) på regional nivå, sköta handels- platser (t.ex. Nord Pool och APX-ENDEX) eller sköta andra marknads- frågor, såsom kapacitetshantering och balansering. Kravet på över- vakningsplan gäller endast om det bland de företag som deltar i

samarbetet finns ”vertikalt integrerade systemansvariga för överförings-

20

systemen”. Med detta uttryck avses företag som bedriver stamnäts- Prop. 2011/12:77 verksamhet och samtidigt ingår i samma koncern som ett företag som

bedriver produktion av eller handel med el. I Sverige är en sådan vertikal integration inte tillåten enligt de nya bestämmelserna om åtskilt ägande, som finns i 3 kap. 1 f–1 j §§ ellagen. Det är dock tänkbart att ett vertikalt integrerat företag från ett land som tillåter vertikalt integrerade stamnäts- företag kan komma att delta i ett regionalt samarbete som etableras i Sverige.

Bestämmelserna om åtskilt ägande hindrar dock inte att ett stamnäts- företag i Sverige ingår i samma koncern som ett företag som bedriver produktion av el som uteslutande är knuten till driften av stamnätsföre- tagets ledningsnät. Någon skyldighet att upprätta en övervakningsplan bör därför inte uppkomma endast därför att stamnätsföretaget ingår i en koncern med ett sådant produktionsföretag.

Övervakningsplanens innehåll

I enlighet med vad som anges i artikel 6.4 i elmarknadsdirektivet ska det av övervakningsplanen framgå vilka åtgärder som ska vidtas för att förhindra diskriminerande och konkurrensbegränsande beteende gentemot övriga aktörer på elmarknaden. I planen ska särskilt anges de särskilda skyldigheter som samriskföretagets anställda har för att förhindra detta. Planen måste vidare ges in till ACER för godkännande.

Övervakningsansvariga

Enligt elmarknadsdirektivet ska de övervakningsansvariga för de vertikalt integrerade systemansvariga för överföringssystemen oberoende av andra kontrollera att planen följs. Som redan nämnts är sådana vertikalt integrerade systemansvariga inte tillåtna i Sverige. Något behov av att i svensk lag reglera skyldigheterna för de övervakningsansvariga bedöms därför inte finnas.

21

4.3

Samriskföretag på naturgasområdet

Prop. 2011/12:77

Regeringens förslag: Ett samriskföretag ska upprätta och genomföra en övervakningsplan, om

företaget har bildats för att genomföra ett samarbete som syftar till att integrera marknader för naturgas i Norden och Europeiska unionen, och

det bland de företag som har bildat samriskföretaget finns en transmissionsnätsoperatör som ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas.

Av övervakningsplanen ska det framgå vilka åtgärder som samrisk- företaget ska vidta för att förhindra diskriminerande och konkurrens- begränsande beteende gentemot övriga aktörer på naturgasmarknaden. I planen ska dessutom anges de särskilda skyldigheter som företagets anställda har för att förhindra detta.

Övervakningsplanen ska godkännas av byrån för samarbete mellan energitillsynsmyndigheter. Planen ska ges in till byrån för prövning av sådant godkännande.

Promemorians förslag: Överensstämmer i sak med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag

Behovet av lagstiftning

I 3 kap. 9 och 10 §§ naturgaslagen (2005:403) finns bestämmelser om övervakningsplan, som är utformade på samma sätt som motsvarande bestämmelser i ellagen. Bestämmelserna svarar mot artikel 26.2 d i gasmarknadsdirektivet och innebär inte att det finns något allmänt krav på att ett sådant samriskföretag som avses i artikel 7.4 i direktivet ska upprätta en övervakningsplan. Nya föreskrifter om övervakningsplan för samriskföretag bör således införas i naturgaslagen.

Företag som omfattas av skyldigheten

Kravet på övervakningsplan gäller endast om det bland de företag som deltar i ett samriskföretag finns ”vertikalt integrerade systemansvariga för överföringssystemen”. Med detta uttryck avses transmissionsnäts- operatörer som ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas. I Sverige är en sådan vertikal integration inte tillåten enligt de nya bestämmelserna om åtskilt ägande, som finns i 3 kap. 2–2 d §§ naturgaslagen. Det är dock tänkbart att ett vertikalt integrerat företag från ett land som tillåter vertikal integration kan komma att delta i ett regionalt samarbete som etableras i Sverige.

22

Övervakningsplanens innehåll m.m.

Prop. 2011/12:77

När det gäller övervakningsplanens innehåll samt den roll som gasmark-

 

nadsdirektivet ger ACER och de övervakningsansvariga finns inte skäl

 

att göra någon annan bedömning än den som redovisats i avsnitt 4.2 i

 

fråga om samriskföretag på elområdet.

 

5 Villkor för tillträde till infrastruktur

5.1Tillträde till elnät

Regeringens förslag: En nätkoncessionshavare ska inte få ingå avtal om tillträde till en ledning eller ett ledningsnät förrän de metoder som har använts för att utforma avtalsvillkoren har prövats av nätmyndig- heten. Nätmyndigheten ska godkänna metoderna, om de kan antas leda till att avtalen är objektiva och icke-diskriminerande. Prövningen ska dock inte omfatta metoder för att utforma avgifter för överföring av el och för anslutning. Om nätmyndigheten inte godkänner de metoder som föreslås i en ansökan, ska myndigheten i beslutet ange de metoder som i stället ska tillämpas.

Nätmyndighetens beslut ska kunna överklagas till allmän förvalt- ningsdomstol. Beslutet ska dock gälla omedelbart.

Bestämmelserna om förhandsprövning ska dock inte tillämpas på sådana avtal om tillträde till en ledning eller ett ledningsnät som en nätkoncessionshavare ingår före den 1 januari 2013 eller avtal som nätkoncessionshavaren ingår under tiden från det att en ansökan om metodprövning har lämnats in till nätmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan har lämnats in före utgången av augusti 2012.

Promemorians förslag: Överensstämmer i sak med regeringens.

Remissinstanserna: Förvaltningsrätten i Linköping har ifrågasatt utformningen av ikraftträdande- och övergångsbestämmelserna. I övrigt har remissinstanserna tillstyrkt förslaget eller inte framfört några invänd- ningar mot det i sak.

Skälen för regeringens förslag

Elmarknadsdirektivets krav

I artikel 37.6 i elmarknadsdirektivet finns bestämmelser om förhands- prövning av villkor för tillträde till infrastruktur. Tillsynsmyndigheterna, i Sverige nätmyndigheten, ska ansvara för att i förväg fastställa eller godkänna åtminstone metoder för att beräkna eller fastställa villkoren för anslutning och tillträde till nationella nät, inklusive överförings- och distributionstariffer eller deras beräkningsmetoder, tillhandahållande av balanstjänster samt tillträde till gränsöverskridande infrastruktur,

23

inbegripet förfaranden för kapacitetstilldelning och hantering av över- Prop. 2011/12:77 belastning.

Behovet av lagstiftning

Regeringen har bedömt att lagändringar kan vara påkallade med anled- ning av artikel 37.6 c i direktivet, som gäller tillträde till gränsöver- skridande infrastruktur (prop. 2010/11:70 s. 69).

När det gäller avgifterna för överföring av el och för anslutning finns redan bestämmelser om förhandsprövning i 5 kap. ellagen (1997:857). Även utlandsförbindelser omfattas av förhandsregleringen. Särskilda bestämmelser om sådana förbindelser finns i 5 kap. 24 § ellagen.

Det finns i dag inga bestämmelser om generell förhandsprövning när det gäller andra villkor för tillträde till elnätet än sådana som avser avgifter för överföring av el och för anslutning, vare sig i fråga om ledningar inom landet eller i fråga om utlandsförbindelserna. För att det inte ska råda någon tvekan om att den svenska lagstiftningen uppfyller kraven i artikel 37.6 i elmarknadsdirektivet bör det införas bestämmelser om förhandsprövning även när det gäller andra villkor för tillträde till elnätet än avgifter.

Förhandsprövningens utformning

En lämplig förlaga till en bestämmelse om förhandsprövning av villkor finns i 8 kap. 4 a § andra stycket ellagen. Där föreskrivs att den system- ansvariga myndigheten inte får ingå balansavtal förrän de metoder som har använts för att utforma avtalen har godkänts av nätmyndigheten. Godkännande ska lämnas, om metoderna kan antas leda till att avtalen uppfyller kraven enligt paragrafens första stycke, där det anges att villkoren i balansavtalen ska vara objektiva och icke-diskriminerande. Bestämmelsen har tillkommit med anledning av artikel 23.2 b i Europa- parlamentets och rådets direktiv 2003/54/EG av den 26 juni 2003 om gemensamma regler för den inre marknaden för el och om upphävande av direktiv 96/92/EG (EUT L 176, 15.7.2003, s. 37, Celex 32003L0054), som i huvudsak motsvaras av artikel 37.6 b i elmarknadsdirektivet.

Regeringen föreslår mot denna bakgrund att en ny bestämmelse införs i 4 kap. 1 a § ellagen, där det föreskrivs att en nätkoncessionshavare inte får ingå avtal om tillträde till en ledning eller ett ledningsnät förrän de metoder som har använts för att utforma avtalsvillkoren har prövats av nätmyndigheten. Prövningen ska dock inte omfatta metoder för att utforma avgifter för överföring av el och för anslutning.

Av 4 kap. 1 § ellagen framgår att nättariffer ska vara objektiva och icke-diskriminerande. Med nättariff avses i ellagen inte bara avgifter utan även övriga villkor för överföring av el och för anslutning till en ledning eller ett ledningsnät (1 kap. 5 §). Syftet med förhandsprövningen är att säkerställa att avtalsvillkoren uppfyller dessa krav.

Det enklaste sättet att i förhand pröva metoderna för utformningen av avtalsvillkor torde vara att på ansökan av ett nätföretag granska de standardvillkor som företaget använder för att utforma avtalen med de

24

enskilda kunderna. Förfarandet kan därför antas bli förhållandevis Prop. 2011/12:77 okomplicerat.

Tillsyn i efterhand

Nätmyndigheten utövar redan i dag tillsyn över att nätföretagen följer föreskrifterna i 4 kap. 1 § ellagen. Det tillhör således myndighetens uppgifter att övervaka att de avtal som företagen ingår med kunderna också i praktiken är objektiva och icke-diskriminerande. Den förhands- granskning som föreslås i propositionen ska inte ersätta en sådan efter- handsgranskning utan bör uppfattas som ett komplement till den tillsyn som äger rum redan i dag.

Överklagande

Nätmyndighetens beslut i frågor om förhandsgodkännande bör kunna överklagas på samma sätt som myndighetens beslut enligt 8 kap. 4 a § ellagen. Ett sådant beslut får överklagas till allmän förvaltningsdomstol. Prövningstillstånd krävs vid överklagande till kammarrätten.

I enlighet med artikel 37.12 i elmarknadsdirektivet ska nätmyndig- hetens beslut gälla utan hinder av att det överklagas.

Övergångsbestämmelser

När lagen träder i kraft får nätkoncessionshavaren inte ingå avtal förrän de metoder som används för att utforma avtalsvillkoren i berörda delar har godkänts av nätmyndigheten. De avtal som nätkoncessionshavaren har ingått före ikraftträdandet bör dock inte bli ogiltiga. Nätmyndigheten kommer också att behöva tid efter ikraftträdandet för att pröva ansökningar om godkännande. För att göra detta möjligt bör det i över- gångsbestämmelser till en början anges att bestämmelserna om förhands- prövning inte ska tillämpas på sådana avtal som ingås före den 1 januari 2013. Förvaltningsrätten i Linköping har inte funnit någon närmare förklaring i promemorian till varför ikraftträdandet inte kan avvaktas till detta datum. Det kan därför som ett förtydligande anmärkas att det är motiverat med en övergångslösning oavsett vilken tidpunkt som väljs för ikraftträdandet.

Det är tänkbart att nätmyndigheten i några fall inte hinner meddela beslut i frågan om godkännande av de metoder som ska användas för att utforma avtalsvillkoren före utgången av år 2012. För att den berörda nätkoncessionshavaren ändå ska kunna ingå nya avtal under tiden innan nätmyndigheten har fattat beslut i frågan bör det föreskrivas att de nya bestämmelserna inte heller ska tillämpas på avtal som nätkoncessions- havaren ingår under tiden från det att en ansökan om metodprövning har lämnats in till nätmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan lämnas in före utgången av augusti 2012.

25

5.2

Tillträde till förgasningsanläggning

Prop. 2011/12:77

Regeringens förslag: Den som innehar en förgasningsanläggning ska inte få börja tillämpa sin tariff för tillträde förrän de metoder som har använts för att utforma tariffen har godkänts av tillsynsmyndigheten. Godkännande ska lämnas, om metoderna kan antas leda till att tariffen uppfyller kraven på att den ska vara objektiv och icke- diskriminerande.

Bestämmelserna om förhandsprövning ska dock inte tillämpas på sådana tariffer för tillträde till en förgasningsanläggning som gäller för tiden före det räkenskapsår som börjar den 1 januari 2013 eller närmast därefter eller sådan tariff för tillträde som anläggningens innehavare tillämpar från det att en ansökan om godkännande har lämnats in till tillsynsmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan har lämnats in före utgången av augusti 2012.

Promemorians förslag: Överensstämmer i sak med regeringens.

Remissinstanserna: Förvaltningsrätten i Linköping har ifrågasatt utformningen av ikraftträdande- och övergångsbestämmelserna. I övrigt har remissinstanserna tillstyrkt förslaget eller inte framfört några invändningar mot det i sak.

Skälen för regeringens förslag

Tariffbegreppet i naturgaslagen

I 1 kap. 5 § ellagen finns en definition av nättariffer. Med sådana tariffer avses i ellagen avgifter och övriga villkor för överföring av el och för anslutning till en ledning eller ett ledningsnät. Någon motsvarande uttrycklig definition finns inte i 2005 års naturgaslag. Detta ska dock ses mot bakgrund av Lagrådets yttrande över förslaget till ny naturgaslag. I lagförslaget fanns definitioner av överförings- och lagertariff samt tariff för tillträde till en förgasningsanläggning. Lagrådet konstaterade emellertid att det fick anses klart att med ”tariff” avsågs såväl avgifter som övriga villkor utan att detta uttryckligen föreskrevs i lagtexten (prop. 2004/05:62 s. 429). Den nya naturgaslagen kom i denna del att utformas i enlighet med Lagrådets synpunkter.

De bestämmelser i naturgaslagen som gäller tariffer för överföring eller tillträde tar således sikte även på andra villkor än bara avgifterna för tjänsterna.

Behovet av en förhandsreglering

Som regeringen redan har konstaterat behöver frågan om villkoren för tillträde till LNG-anläggningar (förgasningsanläggningar) och gräns- överskridande infrastruktur utredas ytterligare (prop. 2010/11:70

s.157 f.).

De aktuella kraven finns i artikel 41.6 a och c i gasmarknadsdirektivet.

Tillsynsmyndigheterna ska ansvara för att i förväg fastställa eller

26

godkänna åtminstone metoder för att beräkna eller fastställa villkoren för Prop. 2011/12:77 tillträde till förgasningsanläggningar samt tillträde till gränsöver-

skridande infrastruktur, inbegripet förfaranden för kapacitetstilldelning och hantering av överbelastning.

När det gäller villkoren för överföring av naturgas och för anslutning finns redan bestämmelser om förhandsprövning i 6 kap 5 § naturgaslagen (2005:403). Den som bedriver överföring av naturgas får inte börja tillämpa sin avgift och övriga villkor för anslutning eller sin över- föringstariff förrän de metoder som har använts för att utforma avgiften eller tariffen har godkänts av tillsynsmyndigheten. Godkännande ska lämnas, om metoderna kan antas leda till att avgiften eller tariffen uppfyller kraven på att den ska vara objektiv och icke- diskriminerande. Utlandsförbindelser till Sverige omfattas av förhandsregleringen och, som framgått ovan, omfattar förhandsregleringen även förfaranden för kapacitetstilldelning och hantering av överbelastning.

Det finns i dag inga bestämmelser om förhandsprövning när det gäller tillträde till förgasningsanläggningar. För att den svenska lagstiftningen ska uppfylla kraven i artikel 41.6 i gasmarknadsdirektivet bör det införas bestämmelser om en sådan prövning. Den förhandsreglering som i dag gäller i fråga om överföring och anslutning bör därför omfatta även tillträde till förgasningsanläggningar.

Övergångsbestämmelser

När lagen träder i kraft får innehavaren av en förgasningsanläggning inte tillämpa sin tariff för tillträde till anläggningen förrän de metoder som används för att utforma tariffen har godkänts av tillsynsmyndigheten. De tariffer som tillämpas vid ikraftträdandet bör dock inte automatiskt bli ogiltiga. Tillsynsmyndigheten kan också behöva tid efter ikraftträdandet för att pröva en ansökan om godkännande. Det bör därför i en övergångs- bestämmelse anges att den nya förhandsregleringen inte ska tillämpas på sådana tariffer som gäller för tiden före det räkenskapsår som börjar den 1 januari 2013 eller närmast därefter. Som har anmärkts i avsnitt 5.1 är det motiverat med en övergångslösning oavsett vilken tidpunkt som väljs för ikraftträdandet.

Det är tänkbart att tillsynsmyndigheten inte hinner meddela beslut i frågan om godkännande innan det nya räkenskapsåret börjar. För att säkerställa att en innehavare av en förgasningsanläggning kan tillämpa sina tariffer under tiden fram till dess att tillsynsmyndigheten har meddelat beslut i frågan bör det därför föreskrivas att bestämmelsen om förhandsprövning inte ska tillämpas på tariff som en anläggningsinne- havare tillämpar från det att en ansökan om godkännande har lämnats in till tillsynsmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan har lämnats in före utgången av augusti 2012.

27

6

Åtskillnad av naturgaslagring

Prop. 2011/12:77

6.1Tydligare krav på åtskillnad av lagringsverksamhet

Regeringens förslag: Ett företag som innehar en lagringsanläggning ska inte få bedriva produktion av naturgas. Om ett sådant företag ingår i en koncern, ska dess organisation och beslutsordning vara skild från företag som bedriver produktion av eller handel med naturgas.

Åtskillnadskraven ska inte gälla företag som innehar en förgasnings- anläggning.

Promemorians förslag: Överensstämmer i sak med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag

Gasmarknadsdirektivets krav

I artikel 15 i gasmarknadsdirektivet finns bestämmelser om åtskillnad av systemansvariga för lagringssystem. Av artikel 15.1 framgår att system- ansvariga för lagringssystem som ingår i vertikalt integrerade företag ska vara oberoende av annan verksamhet som inte rör överföring eller lagring av naturgas, åtminstone när det gäller juridisk form, organisation och beslutsfattande. Av artikel 15.2 framgår att vissa minimikriterier ska gälla för att säkerställa att den systemansvarige för lagringssystemet är oberoende. Bland annat får enligt artikel 15.2 a de personer som ansvarar för ledningen av den systemansvarige för lagringssystemet inte ingå i företagsstrukturer i det integrerade naturgasföretag som direkt eller indirekt ansvarar för den dagliga driften när det gäller produktion eller leverans av naturgas.

Artikel 15 i gasmarknadsdirektivet gäller endast lagringsanläggningar som är tekniskt eller ekonomiskt nödvändiga för ett effektivt tillträde till systemet för leverans till kunderna i enlighet med artikel 33.

Den svenska lagstiftningen

Bestämmelser om åtskillnad av lagrings- och förgasningsanläggningar finns i 4 kap. 2 § naturgaslagen (2005:403). Där stadgas till en början att ett företag som innehar en lagringsanläggning eller en förgasnings- anläggning inte får bedriva handel med naturgas. I ett sådant företag får inte en styrelseledamot, verkställande direktör eller firmatecknare samtidigt vara styrelseledamot, verkställande direktör eller firmatecknare i ett företag som bedriver handel med naturgas.

Bestämmelserna i 4 kap. 2 § naturgaslagen svarar endast delvis mot de krav som ställs upp i artikel 15 i gasmarknadsdirektivet när det gäller innehavare av lagringsanläggningar. Kraven i direktivet svarar i allt väsentligt mot krav på funktionell åtskillnad som enligt artikel 26.1 och 26.2 i elmarknadsdirektivet gäller för företag som bedriver eldistribution.

De kraven har i Sverige genomförts genom bestämmelserna i 3 kap.

28

1 a–1 e, 17 och 17 a §§ ellagen (1997:857). Sådana krav finns även i Prop. 2011/12:77 artikel 26 i gasmarknadsdirektivet, men när det gäller naturgasföretag har

Sverige valt att inte införa några bestämmelser om funktionell åtskillnad med hänvisning till den möjlighet till undantag som finns enligt artikel 26.4 i direktivet (jfr prop. 2004/05:62 s. 152–155 och prop. 2010/11:70 s. 151).

Mot bakgrund av det som nu har redovisats bör det i fråga om inne- havare av lagringsanläggningar införas bestämmelser om funktionell åtskillnad i den svenska naturgaslagen. Föreskrifterna bör utformas på i huvudsak samma sätt som bestämmelserna om funktionell åtskillnad i 3 kap. ellagen. Regeringen föreslår därför att det av 4 kap. 2 § naturgas- lagen ska framgå att om ett företag som innehar en lagringsanläggning ingår i en koncern ska dess organisation och beslutsordning vara skild från företag som bedriver produktion av eller handel med naturgas. Vidare bör det tydliggöras att ett sådant anläggningsföretag inte självt får bedriva produktion av naturgas.

Förgasningsanläggningar

Av artikel 29 i gasmarknadsdirektivet framgår att artikel 26.1, som inne- håller bestämmelser om åtskillnad av systemansvariga för distributions- systemet, inte ska hindra verksamheten för en systemansvarig med kombinerat ansvar för transmissions-, LNG-, lagrings- och distributions- systemen, under förutsättning att denne systemansvarige följer artikel 9.1, eller artiklarna 14 och 15, eller kapitel IV, eller omfattas av artikel 49.6. Innebörden av detta är att den kombinerat systemansvarige, i tillämpliga fall, måste leva upp till de krav på åtskillnad som direktivet ställer upp i fråga om transmissionsnätsoperatörer och innehavare av lagringsanläggningar.

Några åtskillnadskrav som tar sikte på LNG-system (förgasnings- anläggningar) utanför området för kombinerat systemansvar finns däremot inte i gasmarknadsdirektivet. Att kombinerat systemansvariga som bedriver transmission eller distribution av naturgas eller innehar lagringsanläggningar lever upp till åtskillnadskraven säkerställs genom en rad föreskrifter i naturgaslagen. Några särskilda bestämmelser om åtskillnad av förgasningsanläggningar är därför inte nödvändiga. Bestämmelserna om åtskillnad i 4 kap. naturgaslagen bör därför inte gälla förgasningsanläggningar.

6.2Yrkesmässiga intressen

Regeringens förslag: Ett företag som innehar en lagringsanläggning och ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas ska inte få bevilja anställda i ledande ställning löner eller andra förmåner som grundar sig på resultatet i de delar av koncernen som bedriver sådan produktion eller handel.

Promemorians förslag: Överensstämmer med regeringens.

29

Remissinstanserna har tillstyrkt förslaget eller inte framfört några Prop. 2011/12:77 invändningar mot det.

Skälen för regeringens förslag: Av artikel 15.2 b i gasmarknads- direktivet framgår att lämpliga åtgärder ska vidtas för att se till att de yrkesmässiga intressena hos de personer som ansvarar för ledningen av den systemansvarige för lagringssystemet beaktas på ett sätt som säker- ställer att dessa personer kan agera självständigt.

Ett motsvarande krav i artikel 26.2 b i elmarknadsdirektivet har i Sverige genomförts genom 3 kap. 1 c § ellagen (jfr prop. 2008/09:216 s. 15). Regeringen föreslår att en ny bestämmelse införs i 4 kap. 2 a § naturgaslagen och att föreskrifterna i ellagen används som förebild. Ett företag som innehar en lagringsanläggning och ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas ska inte få bevilja anställda i ledande ställning löner eller andra förmåner som grundar sig på resultatet i de delar av koncernen som bedriver sådan produktion eller handel.

6.3Faktisk beslutanderätt

Regeringens förslag: Ett företag som innehar en lagringsanläggning och ingår i en koncern där ett annat företag bedriver produktion av eller handel med naturgas ska, tillsammans med sitt moderföretag, se till att det har en i förhållande till övriga företag i koncernen faktisk och självständig beslutanderätt när det gäller de tillgångar som behövs för att trygga drift, underhåll och utbyggnad av anläggningen.

Det sagda ska inte hindra att moderföretaget har sådan insyn och utövar sådan styrning av anläggningsföretaget som krävs för att säker- ställa en rimlig avkastning på de investeringar som gjorts i anlägg- ningsföretaget. Moderföretaget ska dock inte få ge instruktioner åt anläggningsföretaget om företagets löpande förvaltning eller beslut att bygga eller modernisera en lagringsanläggning, om inte instruk- tionerna avser åtgärder eller beslut som går utöver de ekonomiska ramar som fastställts av anläggningsföretagets bolagsstämma eller motsvarande organ.

Promemorians förslag: Överensstämmer i sak med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag: Av artikel 15.2 c i gasmarknads- direktivet framgår att den systemansvarige för lagringssystemet ska ha faktisk beslutanderätt, oberoende av det integrerade naturgasföretaget, när det gäller de tillgångar som behövs för drift, underhåll och utveckling av lagringsanläggningar. Detta ska inte hindra förekomsten av lämpliga samordningssystem för att säkerställa ett skydd för moderbolagets ekonomiska och förvaltningsmässiga övervakningsrättigheter när det gäller avkastningen på tillgångar i ett dotterbolag. Detta ska särskilt göra det möjligt för moderbolaget att godkänna den årliga finansieringsplan eller det motsvarande instrument som upprättas av den systemansvarige för lagringssystemet och att fastställa övergripande gränser för dess

30

dotterbolags skuldsättningsnivå. Det ska inte vara tillåtet för moder- Prop. 2011/12:77 bolaget att ge instruktioner för den dagliga driften eller om enskilda

beslut beträffande uppförande eller uppgradering av lagringsanlägg- ningar, så länge dessa beslut inte överskrider villkoren i den godkända finansieringsplanen eller motsvarande instrument.

En motsvarande reglering finns i dag i 3 kap. 1 d § ellagen (jfr prop. 2008/09:216 s. 16–25). Bestämmelser med i huvudsak samma innehåll bör införas i naturgaslagen i fråga om den faktiska beslutanderätten för företag som innehar en lagringsanläggning. I propositionen föreslås sådana bestämmelser i 4 kap. 2 b § naturgaslagen.

6.4Övervakningsplan

Regeringens förslag: Ett företag som innehar en lagringsanläggning och ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas ska upprätta en övervakningsplan och se till att planen följs.

Av övervakningsplanen ska det framgå vilka åtgärder som företaget ska vidta för att motverka diskriminerande beteende gentemot övriga aktörer på naturgasmarknaden. I planen ska anges de särskilda skyldigheter som företagets anställda har för att motverka detta.

Den som är skyldig att upprätta en övervakningsplan ska årligen upprätta en rapport över de åtgärder som vidtagits. Rapporten ska ges in till tillsynsmyndigheten och i samband med detta offentliggöras av ingivaren.

Regeringen eller, efter regeringens bemyndigande, tillsynsmyndig- heten ska få meddela föreskrifter om innehållet i övervakningsplanen och om offentliggörandet av den årliga rapporten.

Promemorians förslag: Överensstämmer i sak med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag: I artikel 15.2 d i gasmarknads- direktivet finns bestämmelser om övervakningsplan. De motsvarar i huvudsak de krav på övervakningsplan som finns i artikel 26.2 d i direktivet och som har genomförts i Sverige genom 3 kap. 9 och 10 §§ naturgaslagen. Till skillnad från vad som anges i den artikeln finns dock i artikel 15.2 d inga särskilda föreskrifter om den övervakningsansvariges oberoende.

Regeringen föreslår att bestämmelser om övervakningsplan i enlighet med gasmarknadsdirektivets krav införs i 4 kap. 7 och 8 §§ naturgas- lagen.

6.5Undantag

Regeringens förslag: Regeringen eller, efter regeringens bemyn- digande, tillsynsmyndigheten ska få meddela föreskrifter om undantag från kraven på åtskillnad när det gäller lagringsanläggningar.

31

Prop. 2011/12:77

Promemorians förslag: Överensstämmer med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag: Av artikel 15.1 andra stycket i gasmarknadsdirektivet framgår att artikeln endast ska gälla lagrings- anläggningar som är tekniskt eller ekonomiskt nödvändiga för ett effektivt tillträde till systemet för leverans till kunderna i enlighet med artikel 33. I Sverige finns för närvarande endast en lagringsanläggning, som ligger i berget Skallen utanför Halmstad. Något praktiskt behov av ett undantag kan i nuläget inte antas finnas.

Bestämmelser om undantag kan föras in direkt i naturgaslagen. Det som framför allt talar emot en sådan lösning är att det kan visa sig vara svårt att närmare precisera vilka anläggningar som är tekniskt eller ekonomiskt nödvändiga för ett effektivt tillträde till systemet för leverans till kunderna. Det kan därför bli aktuellt med föreskrifter av en sådan karaktär att det är motiverat att de meddelas på lägre normnivå än lag. Det finns inte heller något starkt behov av en reglering i lagform.

I propositionen föreslås därför att det i 4 kap. 9 § naturgaslagen införs ett bemyndigande för regeringen eller, efter regeringens bemyndigande, tillsynsmyndigheten att meddela föreskrifter om undantag från kraven på åtskillnad.

7 Konfidentiell behandling av uppgifter

7.1Gasmarknadsdirektivets krav

Förbud mot att röja kommersiellt känsliga uppgifter

I artikel 16 i gasmarknadsdirektivet finns bestämmelser om konfidentiell behandling av uppgifter.

Av artikel 16.1 i gasmarknadsdirektivet framgår till en början att vissa företag ska behandla kommersiellt känsliga uppgifter som erhålls i verk- samheten konfidentiellt och förhindra att sådana uppgifter om den egna verksamheten som kan vara kommersiellt fördelaktiga röjs på ett diskriminerande sätt. De företag som berörs är systemansvariga för och ägare till överförings- och lagringssystem eller LNG-anläggningar. Med den terminologi som används i naturgaslagen (2005:403) är det transmissionsnätsoperatörer samt innehavare av lagrings- och förgas- ningsanläggningar som avses. De krav som i direktivet riktar sig mot ”ägare till överföringssystem” (transmission system owner, TSOW) är tillämpliga endast i medlemsstater som infört andra åtskillnadslösningar än åtskilt ägande enligt artikel 9.1–9.3 och 9.6 i gasmarknadsdirektivet. Med det som i artikel 16 benämns ”företag” bör vidare i detta samman- hang förstås såväl fristående företag som koncerner.

Ett naturgasföretag som berörs av bestämmelsen ska i synnerhet inte röja kommersiellt känsliga uppgifter för övriga delar av företaget eller koncernen såvida inte detta är nödvändigt för att genomföra en affärs-

transaktion.

32

När det gäller ägare till överföringssystem (TSOW) ställs vidare ett Prop. 2011/12:77 särskilt krav upp för att efterlevnaden av reglerna om åtskillnad av

information ska kunna säkerställas. Den del av företaget eller koncernen som bedriver överföring av naturgas och övriga delar får inte ha gemen- samma funktioner, t.ex. gemensam juridisk avdelning, med undantag för rent administrativa funktioner eller IT-funktioner. Kravet är dock inte relevant i Sverige, som har valt en ordning med åtskilt ägande.

Missbruk av kommersiellt känsliga uppgifter

Av artikel 16.2 framgår att transmissionsnätsoperatörer och innehavare av lagrings- och förgasningsanläggningar, i samband med anknutna företags försäljning eller köp av naturgas, inte får missbruka kommer- siellt känsliga uppgifter som erhållits från tredje part i samband med tillhandahållande av eller förhandlingar om tillträde till systemet.

Offentliggörande av information

I artikel 16.3 stadgas att information som är nödvändig för en effektiv konkurrens och en välfungerande marknad ska offentliggöras. Denna skyldighet påverkar inte kravet att behandla kommersiellt känsliga uppgifter konfidentiellt.

7.2

Förbud mot att röja uppgifter

 

 

 

Regeringens förslag: Om en transmissionsnätsoperatör eller ett före-

 

tag som innehar en lagrings- eller förgasningsanläggning bedriver

 

även annan verksamhet, ska företaget säkerställa att kommersiellt

 

känsliga uppgifter inte görs tillgängliga för de delar av företaget som

 

bedriver annan verksamhet. Om företaget ingår i en koncern, ska det

 

säkerställa att kommersiellt känsliga uppgifter inte görs tillgängliga

 

för företag i koncernen som bedriver annan verksamhet. Det som nu

 

har sagts ska inte hindra att kommersiellt känsliga uppgifter görs

 

tillgängliga om det är nödvändigt för att genomföra en affärstransak-

 

tion.

 

 

Promemorians förslag: Överensstämmer i sak med regeringens.

 

Remissinstanserna har tillstyrkt förslaget eller inte framfört några

 

invändningar mot det.

 

Skälen för regeringens förslag

 

Behovet av lagstiftning

 

När det gäller det allmänna förbudet mot att röja kommersiellt känsliga

 

uppgifter på ett diskriminerande sätt saknas skäl att införa särskilda

 

bestämmelser i naturgaslagstiftningen. Regeringen har tidigare, i fråga

 

om motsvarande krav i artikel 10 i Europaparlamentets och rådets

 

direktiv 2003/55/EG av den 26 juni 2003 om gemensamma regler för den

 

inre marknaden för naturgas och om upphävande av direktiv 98/30/EG

33

(EUT L 176, 15.7.2003, s. 57, Celex 32003L0055), bedömt att det inte Prop. 2011/12:77 kommit fram några starkt vägande skäl för att införa särskilda regler om

tystnadsplikt för företagen på naturgasmarknaden (prop. 2004/05:62 s. 110 f.). I det sammanhanget konstaterade regeringen vidare att det enligt konkurrenslagstiftningens regel om missbruk av dominerande ställning inte var tillåtet att i en konkurrensutsatt verksamhet utnyttja information som man hade fått tillgång till i en monopolverksamhet.

Det nya gasmarknadsdirektivet innebär emellertid att krav har tillkommit i förhållande till direktiv 2003/55/EG. Det finns nu särskilda krav på att inte röja uppgifter ens för andra delar av företaget.

Regleringens utformning

Det framstår som en alltför ingripande åtgärd att införa exempelvis bestämmelser om tystnadsplikt för de anställda i ett naturgasföretag i förhållande till andra delar av företaget eller andra företag i samma koncern. Gasmarknadsdirektivets krav kan i stället genomföras genom att det berörda företaget åläggs en skyldighet att säkerställa att kommersiellt känsliga uppgifter om transmission, lagring eller förgasning av naturgas inte görs tillgängliga för de delar av företaget eller koncernen som bedriver annan verksamhet.

I enlighet med vad som anges i artikel 16.1 i gasmarknadsdirektivet ska det fortfarande vara möjligt att göra kommersiellt känslig informa- tion tillgänglig om det är nödvändigt för att genomföra en affärstransak- tion.

Regeringen föreslår att de nya bestämmelserna inför i 3 kap. 2 f § och 4 kap. 2 c och 2 d §§ naturgaslagen.

7.3Offentliggörande av information

Regeringens förslag: Regeringen eller, efter regeringens bemyn- digande, tillsynsmyndigheten ska få meddela föreskrifter om skyldig- het för transmissionsnätsoperatörer och företag som innehar en lagrings- eller förgasningsanläggning att offentliggöra information som har betydelse för naturgasmarknadens funktion.

Promemorians förslag: Överensstämmer med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag: I artikel 16.3 i gasmarknadsdirektivet stadgas att information som är nödvändig för en effektiv konkurrens och en välfungerande marknad ska offentliggöras.

Ett allmänt hållet krav att offentliggöra information framstår som alltför svårtolkat för att det ska vara lämpligt att införa en bestämmelse om en sådan skyldighet. Det bör i stället vara möjligt för regeringen eller, efter regeringens bemyndigande, tillsynsmyndigheten att meddela före- skrifter om skyldighet för berörda naturgasföretag att offentliggöra information som har betydelse för naturgasmarknadens funktion. Sådana

föreskrifter kan bli aktuella om det visar sig att företagen hemlighåller

34

sådan information och att andra bestämmelser om offentliggörande, t.ex. Prop. 2011/12:77 i 6 kap. 4 § naturgaslagen, inte är tillämpliga.

Regeringen föreslår att nya normgivningsbemyndiganden införs i 3 kap. 12 § och 4 kap. 10 § naturgaslagen.

8 Ny naturgasinfrastruktur

8.1Bakgrund

I 9 kap. naturgaslagen (2005:403) finns bestämmelser som gör det möjligt för den som planerar att bygga en naturgasledning, en lagrings- anläggning eller en förgasningsanläggning att få undantag från naturgas- lagstiftningens bestämmelser om juridisk och personell åtskillnad, om anslutning av naturgasledning, om överföring av naturgas, om mätning och rapportering av överförd naturgas, om anskaffande av energi, om övervakningsplan, om lagring av naturgas, om tillträde till förgasnings- anläggningar, om anslutningsavgifter och tariffer samt om övergripande systemansvar och balansansvar (3 kap. 2–2 d, 5, 6 och 8–10 §§, 4 kap. 2, 5 och 6 §§ samt 6 och 7 kap. naturgaslagen). Ett ärende om undantag utreds av tillsynsmyndigheten som med ett eget yttrande överlämnar ärendet till regeringen för beslut.

Bestämmelserna i 9 kap. naturgaslagen har tillkommit mot bakgrund av kraven i artikel 22 i Europaparlamentets och rådets direktiv 2003/55/EG av den 26 juni 2003 om gemensamma regler för den inre marknaden för naturgas och om upphävande av direktiv 98/30/EG.

8.2Nya krav för att bevilja undantag

8.2.1Undantagets omfattning

Regeringens förslag: Naturgasinfrastruktur ska kunna beviljas undantag från naturgaslagens bestämmelser om avgränsning av transmissionsverksamhet, tillträde för tredje part till naturgas- ledningar, lagrings- och förgasningsanläggningar och förhands- reglering av tariffer.

Ett beslut om undantag ska få avse hela eller en del av kapaciteten i den berörda ledningen eller anläggningen.

Promemorians förslag: Överensstämmer med regeringens. Remissinstanserna: Naturvårdsverket har anfört att de föreslagna

ändringarna kommer att ytterligare underlätta utbyggnaden av naturgas- infrastruktur, vilket riskerar att binda upp energisystemet för en lång tid framöver i fossila bränslen och ifrågasatt om den aktuella ändringen krävs för att gasmarknadsdirektivets syfte ska anses uppnått. Övriga remissinstanser har tillstyrkt förslaget eller inte framfört några invänd- ningar mot det.

35

Skälen för regeringens förslag

Prop. 2011/12:77

Skyldigheter som undantas

Artikel 36 i gasmarknadsdirektivet svarar i huvudsak mot artikel 22 i direktiv 2003/55/EG. De nya bestämmelserna skiljer sig dock i några avseenden från kraven i det äldre direktivet.

Av artikel 36.1 i gasmarknadsdirektivet framgår att undantag får göras från bestämmelserna i artiklarna 9, 32, 33, 34, 41.6, 41.8 och 41.10.

I artikel 9 finns bestämmelser om åtskillnad av transmissions- verksamhet, som i Sverige har genomförts genom 3 kap. 2–2 d §§ natur- gaslagen.

Bestämmelserna i artikel 32 i gasmarknadsdirektivet gäller tillträde för tredje part till naturgasledningar och förgasningsanläggningar. Kraven har införlivats i svensk rätt genom bestämmelser i naturgaslagen om tillträde till naturgasledningar (3 kap. 5 och 6 §§) och förgasnings- anläggningar (4 kap. 6 §) samt om anslutningsavgifter och tariffer (6 kap.).

I artikel 33 i gasmarknadsdirektivet finns bestämmelser om tillträde till lagringsanläggningar. Kraven har i Sverige genomförts genom 4 kap. 5 § och 6 kap. 2, 3 a och 4 §§ naturgaslagen.

I artikel 41.6 i gasmarknadsdirektivet föreskrivs att tillsynsmyndig- heterna ska ansvara för att i förväg fastställa eller godkänna åtminstone metoder för att beräkna eller fastställa villkoren för anslutning och tillträde till nationella gasnät, tillträde till förgasningsanläggningar, tillhandahållande av balanstjänster och tillträde till gränsöverskridande infrastruktur. I Sverige finns motsvarande bestämmelser i 6 kap. 5 § och 7 kap. 5 § naturgaslagen.

Av artikel 41.8 i gasmarknadsdirektivet framgår att när det gäller fast- ställande eller godkännande av tariffer eller metoder och av balans- tjänster ska tillsynsmyndigheterna säkerställa att innehavarna av natur- gasledningar både på kort och lång sikt ges lämpliga incitament att öka effektiviteten, främja integrationen av marknaden och säkra leveranser samt stödja forskningsverksamheten på området. Enligt artikel 41.10 ska tillsynsmyndigheterna ha befogenhet att vid behov begära att naturgas- företagen ändrar villkoren för att säkerställa att de är proportionerliga och tillämpas på ett icke-diskriminerande sätt. Kraven i artikel 41.8 och 41.10 har i Sverige genomförts genom de befogenheter som tilldelats tillsyns- myndigheten. I denna del har det dock inte funnits skäl att i särskilda bestämmelser, utöver dem som redan angetts, ålägga naturgasföretagen skyldigheter.

Vad undantaget avser

Av artikel 36.6 i gasmarknadsdirektivet framgår att ett undantag får gälla hela eller delar av den nya infrastrukturens kapacitet. Detsamma gäller kapaciteten hos befintlig infrastruktur med väsentligt utökad kapacitet.

36

Anpassning av de svenska bestämmelserna

Prop. 2011/12:77

De skyldigheter som omfattas av undantag enligt nuvarande 9 kap. 1 §

 

första stycket naturgaslagen motsvarar i stort de skyldigheter som anges i

 

artikel 36.1 i gasmarknadsdirektivet. Samstämmigheten är dock inte

 

fullständig.

 

 

När det gäller befintlig infrastruktur tillåter den nuvarande regleringen

 

i 9 kap. 1 § tredje stycket naturgaslagen undantag endast i fråga om den

 

utökade kapaciteten i ledningen eller anläggningen. I denna fråga är

 

utrymmet för undantag således mindre än vad gasmarknadsdirektivet

 

tillåter.

 

 

Naturvårdsverket har ifrågasatt om en ändring krävs för att gasmark-

 

nadsdirektivets syfte ska anses uppnått. Regeringen konstaterar emeller-

 

tid att det är nödvändigt att anpassa de svenska bestämmelserna så att de

 

överensstämmer med det som anges i direktivet för att detta ska anses

 

genomfört i Sverige.

 

8.2.2

Villkor för förvaltning och tilldelning av kapacitet

 

 

 

Regeringens förslag: Innan ett beslut om undantag meddelas i fråga

 

om naturgasinfrastruktur ska villkor fastställas för hanteringen av

 

kapacitet.

 

 

Villkoren ska säkerställa att

 

alla potentiella användare av ledningen eller anläggningen får möjlighet att anmäla sitt intresse för att teckna avtal om viss kapacitet innan kapaciteten fördelas, och

den kapacitet som inte används görs till föremål för handel på en marknad och att den som har tecknat avtal om kapacitet har möjlighet att bedriva sådan handel.

Den som har ansökt om undantag ska ha fördelat kapaciteten inom sex månader efter det att villkor har fastställts. Ett undantag ska inte få beviljas innan kapaciteten har fördelats.

Promemorians förslag: Överensstämmer med regeringens. Remissinstanserna har tillstyrkt förslaget eller inte framfört några

invändningar mot det.

Skälen för regeringens förslag

Gasmarknadsdirektivets krav

I artikel 36.6 andra och tredje styckena i gasmarknadsdirektivet finns bestämmelser om villkor som ska fastställas i det enskilda fallet i samband med att undantag beviljas. Det som anges i andra stycket inne- bär ingen huvudsaklig ändring i förhållande till direktiv 2003/55/EG och har genomförts genom 9 kap. 3 § andra stycket naturgaslagen, där det framgår att ett beslut om undantag ska förenas med de villkor som behövs för att säkerställa att de krav som gäller som förutsättningar för undantag uppfylls.

37

I artikel 36.6 tredje stycket i gasmarknadsdirektivet finns nya Prop. 2011/12:77 bestämmelser. Där framgår att tillsynsmyndigheten redan innan ett

undantag beviljas ska besluta om vilka regler och system som ska gälla för förvaltning och tilldelning av kapacitet. Enligt reglerna ska alla potentiella användare av infrastrukturen erbjudas att meddela sitt intresse för att teckna avtal om viss kapacitet innan tilldelningen av kapacitet i den nya infrastrukturen sker; detta gäller även kapacitet för eget bruk. Tillsynsmyndigheten ska kräva att reglerna för hantering av överbelast- ning också innebär en skyldighet att erbjuda outnyttjad kapacitet på marknaden och att användare av infrastrukturen ges rätt att handla med sin avtalade kapacitet på andrahandsmarknaden. I sin bedömning av de kriterier som anges i artikel 36.1 a, b och e ska tillsynsmyndigheten beakta resultaten av kapacitetstilldelningen.

Bestämmelserna i artikel 36.6 tredje stycket ska ses mot bakgrund av punkten 35 i ingressen till direktivet. Där anförs bl.a. att för att förstärka de positiva effekterna på konkurrens och försörjningstrygghet av undan- tagna infrastrukturprojekt bör det göras en prövning av marknadens intresse i projektets planeringsfas och att bestämmelserna för hantering av överbelastning bör tillämpas samtidigt.

Regler och system

Uttrycket ”regler och system” kan ge intrycket av att det rör sig om före- skrifter som ska meddelas av tillsynsmyndigheten. Det är dock tydligt att det som avses är villkor som ska fastställas i det enskilda fallet. Villkoren ska fastställas innan ett ärende om undantag avgörs slutligt. Någon motsvarande bestämmelse finns inte i det nuvarande 9 kap. naturgas- lagen. Regeringen föreslår därför att bestämmelser om villkor av detta slag införs i 3 a § i samma kapitel.

I enlighet med vad som stadgas i gasmarknadsdirektivet ska villkoren gälla för hanteringen av kapacitet. De ska säkerställa dels att alla poten- tiella användare av ledningen eller anläggningen får möjlighet att anmäla sitt intresse för att teckna avtal om viss kapacitet innan kapaciteten fördelas, dels att den kapacitet som inte används görs till föremål för handel på en marknad och att den som har tecknat avtal om kapacitet har möjlighet att bedriva sådan handel.

För att den myndighet som prövar frågan om undantag ska kunna beakta resultatet av kapacitetstilldelningen på det sätt som förutsätts i artikel 36.6 tredje stycket i gasmarknadsdirektivet måste tilldelningen ha ägt rum innan frågan avgörs slutligt. Mot den bakgrunden bör det också ställas upp ett krav att den som har ansökt om undantag ska ha fördelat kapaciteten inom en viss tid. Regeringen föreslår att sökanden ska ha fördelat kapaciteten inom sex månader efter det att villkor för hante- ringen av kapacitet har fastställts.

38

8.3

Prövningsmyndighet

Prop. 2011/12:77

 

 

Regeringens förslag: Regeringen meddelar föreskrifter om i vilka fall

 

frågor om undantag prövas av byrån för samarbete mellan energitill-

 

synsmyndigheter och i vilka fall de prövas av tillsynsmyndigheten.

 

Bemyndigandet till regeringen att meddela föreskrifter om hand-

 

läggningen ska upphävas.

 

Promemorians förslag: Överensstämmer med regeringens.

 

Remissinstanserna har tillstyrkt förslaget eller inte framfört några

 

invändningar mot det.

 

Skälen för regeringens förslag

 

Tillsynsmyndighetens prövning

 

Av artikel 36.3 i gasmarknadsdirektivet framgår att den nationella

 

tillsynsmyndigheten, i Sverige Energimarknadsinspektionen, beslutar om

 

undantag i det enskilda fallet.

 

Gränsöverskridande infrastruktur

 

I artikel 36.4 i gasmarknadsdirektivet finns bestämmelser om ny natur-

 

gasinfrastruktur som sträcker sig över mer än en medlemsstats terri-

 

torium. När det gäller sådan gränsöverskridande infrastruktur får byrån

 

för samarbete mellan energitillsynsmyndigheter (ACER) lämna ett

 

rådgivande yttrande till de berörda medlemsstaternas tillsynsmyndigheter

 

inom två månader från den dag då en begäran om undantag mottogs av

 

den sista av dessa tillsynsmyndigheter.

 

Om samtliga berörda tillsynsmyndigheter har kommit överens

 

beträffande begäran om undantag inom sex månader från den dag då

 

begäran mottogs av den sista av dessa tillsynsmyndigheter, ska de

 

informera ACER om detta.

 

Av artikel 36.4 tredje stycket framgår att ACER i vissa fall ska utföra

 

de uppgifter som i artikel 36 tilldelas de berörda medlemsstaternas

 

tillsynsmyndigheter. ACER ska fungera som beslutande organ om de

 

berörda tillsynsmyndigheterna inte har kunnat nå någon överens-

 

kommelse inom sex månader från den dag då begäran om undantag

 

mottogs av den sista av dessa myndigheter. De berörda tillsynsmyndig-

 

heterna får gemensamt begära att sexmånadersperioden ska förlängas

 

med högst tre månader. ACER ska också utföra uppgifterna om de

 

berörda tillsynsmyndigheterna gemensamt begär det.

 

Annan nationell myndighet

 

Av artikel 36.7 i gasmarknadsdirektivet framgår att medlemsstaterna,

 

utan hinder av punkt 3, får föreskriva att tillsynsmyndigheten eller

 

ACER, alltefter omständigheterna, ska avge sitt yttrande om förfrågan

 

om undantag till det relevanta organet i medlemsstaten inför det formella

 

beslutet. Yttrandet ska offentliggöras tillsammans med beslutet.

39

 

 

Sverige har utnyttjat den motsvarande möjligheten enligt direktiv Prop. 2011/12:77 2003/55/EG. Av nuvarande 9 kap. 4 § naturgaslagen framgår sålunda att

ärenden om undantag prövas av regeringen efter ansökan. Tillsyns- myndigheten ska utreda ärendena och därefter, med eget yttrande, över- lämna ärendet till regeringens prövning. Tillsynsmyndigheten ska därvid offentliggöra sitt yttrande.

Enligt nuvarande 9 kap. 5 § naturgaslagen ska ett beslut om undantag

 

av regeringen utan dröjsmål anmälas till Europeiska kommissionen. I

 

9 kap. 6 § finns ett bemyndigande för regeringen att meddela ytterligare

 

föreskrifter som rör handläggning av ansökan om undantag.

 

Beslutande myndighet

 

Utgångspunkten är enligt artikel 36.3 i gasmarknadsdirektivet att den

 

nationella tillsynsmyndigheten ska besluta om undantag. Det är dock

 

enligt artikel 36.7 möjligt för en medlemsstat att föreskriva att tillsyns-

 

myndigheten eller ACER, alltefter omständigheterna, ska avge sitt

 

yttrande om förfrågan om undantag till det relevanta organet i medlems-

 

staten inför det formella beslutet. Det är vidare tillsynsmyndigheten som

 

ska fastställa regler och system enligt artikel 36.6.

 

När det gäller gränsöverskridande infrastruktur skiljer sig prövningen

 

enligt gasmarknadsdirektivet i två viktiga avseenden från det som före-

 

skrivs i direktiv 2003/55/EG. Till att börja med ska ACER ha möjlighet

 

att yttra sig i sådana ärenden. Vidare ska prövningen i vissa fall göras av

 

ACER i stället för en nationell myndighet. Det svenska regelverket måste

 

ändras för att svara mot gasmarknadsdirektivets krav i dessa frågor.

 

Utgångspunkten att det är tillsynsmyndigheten som ska pröva frågorna

 

om undantag är ännu tydligare i gasmarknadsdirektivet än i direktiv

 

2003/55/EG. Det är tillsynsmyndigheten som ska fastställa villkor för

 

kapacitetstilldelningen innan det slutliga beslutet om undantag meddelas.

 

När det gäller gränsöverskridande infrastruktur förutsätts tillsyns-

 

myndigheterna i flera medlemsstater samordna sin prövning. Kan de inte

 

nå en överenskommelse, ska frågan överlämnas till ACER. Mot denna

 

bakgrund finns det starka praktiska skäl som talar för att den svenska

 

nationella tillsynsmyndigheten snarare än regeringen bör pröva frågor

 

om undantag. En sådan ordning är också förenlig med en inriktning på att

 

från regeringen lyfta bort sådana ärenden som inte kräver ställnings-

 

tagande från regeringen som politiskt organ.

 

ACER:s prövning

 

Som framgått ovan finns det situationer där ACER ska pröva frågorna

 

om undantag när ärendet rör gränsöverskridande infrastruktur. Det är

 

därför nödvändigt att i svenska nationella föreskrifter ange när ACER

 

fungerar som prövningsmyndighet i enlighet med det som anges i artikel

 

36.4 i gasmarknadsdirektivet.

 

Ett ärende om undantag som avser gränsöverskridande infrastruktur

 

innebär att en eller flera tillsynsmyndigheter i andra stater måste ta

 

ställning i frågan. Praktiska erfarenheter av en sådan samverkan kan

 

motivera ändringar i de nationella bestämmelserna om förfarandet,

40

 

liksom de riktlinjer som EU-kommissionen beslutar med stöd av artikel Prop. 2011/12:77 36.10 i gasmarknadsdirektivet. Frågorna är inte heller sådana att de måste

regleras i lag. Det framstår mot denna bakgrund som lämpligt att rege- ringen anger förutsättningarna för att ACER ska vara prövnings- myndighet i förordning.

Bestämmelser om handläggningen

Det finns i dag bestämmelser om handläggningen av ärenden om undan- tag i 9 kap. 4 och 5 §§ naturgaslagen. I 6 § i samma kapitel finns ett bemyndigande för regeringen att meddela ytterligare föreskrifter som rör handläggning av ansökan om undantag.

Med hänsyn till att ett annat organ än regeringen ska pröva ärenden om undantag måste även bestämmelserna om förfarandet ändras. Frågorna är inte av sådan beskaffenhet att de måste regleras i lagform, utan ryms inom det område där regeringen kan meddela föreskrifter med stöd av 8 kap. 7 och 11 §§ regeringsformen. Det krävs sålunda inte heller något särskilt normgivningsbemyndigande i naturgaslagen.

Överklagande

Beslut i frågor om undantag meddelas i dag av regeringen som första och enda instans. Någon generell möjlighet att få ett beslut prövat av domstol finns därför inte. Om ett sådant beslut innefattar en prövning av en enskilds civila rättigheter eller skyldigheter i den mening som avses i artikel 6.1 i den europeiska konventionen den 4 november 1950 om skydd för de mänskliga rättigheterna och de grundläggande friheterna (Europakonventionen), kan det bli föremål för rättsprövning i Högsta förvaltningsdomstolen enligt lagen (2006:304) om rättsprövning av vissa regeringsbeslut.

Att frågor om undantag ska prövas av tillsynsmyndigheten innebär inte att det finns skäl att se annorlunda på behovet av domstolsprövning. Regeringen kan i stället meddela föreskrifter i förordning om över- klagande till regeringen.

8.4Behovet av övergångsbestämmelser

Regeringens bedömning: Det krävs inga särskilda övergångs- bestämmelser.

Promemorians bedömning: Överensstämmer med regeringens. Remissinstanserna har inte framfört några invändningar mot bedöm-

ningen.

Skälen för regeringens bedömning: I propositionen föreslås att de nya bestämmelserna ska träda i kraft den 1 juli 2012. Kraven i artikel 36 i gasmarknadsdirektivet skulle ha varit genomförda i nationell rätt senast den 3 mars 2011 (se artikel 54 i direktivet). Det har inte heller fram- kommit några starka praktiska skäl som talar för att ärenden som har

41

inletts före ikraftträdandet undantas från den nya handläggnings- Prop. 2011/12:77 ordningen.

Mot denna bakgrund framstår det som lämpligt att den nya handlägg- ningsordningen tillämpas på såväl ett ärende som inletts före ikraft- trädandet som på ett ärende som inletts efter denna tidpunkt. I avsaknad av en särskild övergångsbestämmelse ska ett ärende som kommit in till regeringen före ikraftträdandet överlämnas till tillsynsmyndigheten för fortsatt handläggning. Någon särskild övergångsbestämmelse behövs alltså inte.

9 Skyldighet att bevara information

Regeringens förslag: Regeringen eller den myndighet som regeringen bestämmer ska få meddela föreskrifter om skyldighet för el- och naturgasleverantörer att dokumentera och bevara uppgifter om leveransavtal, derivatinstrument och transaktioner som gäller sådana avtal eller instrument samt att på begäran lämna sådana uppgifter till en svensk myndighet eller Europeiska kommissionen.

Promemorians förslag: Överensstämmer i huvudsak med regeringens. Remissinstanserna: Finansinspektionen har föreslagit en ändring i de föreslagna lagtexterna för att underlätta tolkningsfrågor i det framtida informationsutbytet mellan behöriga myndigheter för el- och naturgas- marknaderna respektive värdepappersmarknaden. Finansinspektionen anser vidare att skyldigheten för inspektionen att lämna uppgifter till behöriga myndigheter bör regleras i lag. Övriga remissinstanser har till-

styrkt förslaget eller inte framfört några invändningar mot det.

Skälen för regeringens förslag

Elmarknadsdirektivets krav

I artikel 40 i elmarknadsdirektivet finns bestämmelser om skyldighet att bevara information. Av artikel 40.1 framgår till en början att medlems- staterna ska kräva att elhandlare under minst fem år håller relevanta uppgifter om samtliga transaktioner gällande elleveransavtal och elderivat med grossister och systemansvariga för överföringssystemet tillgängliga för de nationella myndigheterna, inklusive de nationella tillsynsmyndigheterna, de nationella konkurrensmyndigheterna och Europeiska kommissionen, för fullgörandet av deras uppgifter.

Enligt artikel 40.2 i elmarknadsdirektivet ska uppgifterna innehålla information om relevanta transaktioner, såsom regler om löptid, tillhandahållande och fullgörande samt information om mängd, datum och tider för verkställande, transaktionspriser och metoder för att identifiera den berörda grossisten liksom specificerad information om alla elleveransavtal och elderivat som inte fullgjorts.

Av artikel 40.3 i elmarknadsdirektivet framgår att tillsynsmyndigheten får besluta att göra delar av denna information tillgänglig för marknads- aktörer, förutsatt att kommersiellt känslig information om enskilda

marknadsaktörer eller individuella transaktioner inte lämnas ut. Denna

42

punkt får inte tillämpas på information om finansiella instrument som Prop. 2011/12:77 omfattas av Europaparlamentets och rådets direktiv 2004/39/EG av den

21 april 2004 om marknader för finansiella instrument och om ändring av rådets direktiv 85/611/EEG och 93/6/EEG och Europaparlamentets och rådets direktiv 2000/12/EG samt upphävande av rådets direktiv 93/22/EEG (EUT L 145, 30.4.2004, s. 1, Celex 32004L0039).

Enligt artikel 40.4 i elmarknadsdirektivet får Europeiska kommissionen anta riktlinjer som fastställer metoder och villkor för bevarande av information liksom form och innehåll när det gäller de uppgifter som ska bevaras för att säkerställa en enhetlig tillämpning av artikeln. Av artikel 40.5 framgår att artikeln inte ska tillämpas i fråga om transaktioner avseende elderivat mellan elhandlare, å ena sidan, och grossister och stamnätsföretag, å andra sidan, förrän kommissionen har antagit sådana riktlinjer.

I artikel 40.6 stadgas att bestämmelserna i artikeln inte får skapa ytter- ligare skyldigheter i förhållande till de berörda myndigheterna för de aktörer som omfattas av direktiv 2004/39/EG. Av artikel 40.7 framgår att om de myndigheter som avses i artikel 40.1 behöver tillgång till de uppgifter som innehas av sådana aktörer, ska de ansvariga myndigheterna enligt det direktivet tillhandahålla de begärda uppgifterna.

Tidigare bedömning

NELGA har pekat på att det i Sverige redan finns en rad bestämmelser om vilken information som ett företag ska spara. Utredningen har också konstaterat att det i ellagstiftningen saknas bestämmelser som anger vilken typ av information som elhandelsföretag ska spara samt vilka myndigheter som ska ha tillgång till denna (SOU 2010:30 s. 203). Rege- ringen (prop. 2010/11:70 s. 73 f.) har konstaterat att det är osäkert om den lagstiftning som utredningen har pekat på är tillräcklig för att helt uppfylla kraven i artikel 40.

Gällande bestämmelser

NELGA har pekat på de bestämmelser som finns främst i bokförings- lagen (1999:1078) och relaterade regler och därutöver på det regelverk som styr de finansiella marknaderna, såsom lagen (2007:528) om värde- pappersmarknaden och förordningen (2007:572) om värdepappers- marknaden. Utredningen har vidare funnit det värt att notera att även Europaparlamentets och rådets förordning (EG) nr 714/2009 av den 13 juli 2009 om villkor för tillträde till nät för gränsöverskridande elhandel och om upphävande av förordning (EG) nr 1228/2003 (EUT L 211, 14.8.2009, s. 15, Celex 32009R0714) innehåller bestämmelser om bevarande av information.

Det kan till en början konstateras att de aktuella kraven i lagen om värdepappersmarknaden endast gäller värdepappersinstitut. Det är därför framför allt av intresse att undersöka i vilken omfattning kraven i artikel 40 i elmarknadsdirektivet är uppfyllda genom bestämmelserna i bokföringslagen, som gäller alla företag som bedriver handel med el.

43

Skyldigheten att bevara information

Prop. 2011/12:77

Ett företag är enligt bokföringslagen skyldigt att löpande bokföra affärs-

 

händelser och se till att det finns verifikationer för alla bokföringsposter.

 

Räkenskapsinformationen ska bevaras.

 

Med affärshändelser avses i bokföringslagen alla förändringar i

 

storleken och sammansättningen av ett företags förmögenhet som beror

 

på företagets ekonomiska relationer med omvärlden, såsom in- och

 

utbetalningar, uppkomna fordringar och skulder samt egna tillskott till

 

och uttag ur verksamheten av pengar, varor eller annat. Med verifikation

 

avses de uppgifter som dokumenterar en affärshändelse eller en vidtagen

 

justering i bokföringen.

 

Av särskilt intresse i detta sammanhang är vad som avses med räken-

 

skapsinformation. Dit räknas bl.a. avtal och andra handlingar av särskild

 

betydelse för att belysa verksamhetens ekonomiska förhållanden samt

 

sådana uppgifter i övrigt som är av betydelse för att det ska gå att följa

 

och förstå de enskilda bokföringsposternas behandling i bokföringen

 

(1 kap. 2 § första stycket 8 bokföringslagen).

 

I 5 kap. 7 § första stycket bokföringslagen stadgas att en verifikation

 

ska innefatta uppgift om när den har sammanställts, när affärshändelsen

 

har inträffat, vad denna avser, vilket belopp den gäller och vilken motpart

 

den berör. I förekommande fall ska verifikationen även innefatta upplys-

 

ning om handlingar eller andra uppgifter som har legat till grund för

 

affärshändelsen samt var dessa finns tillgängliga.

 

I 7 kap. bokföringslagen finns bestämmelser om arkivering av räken-

 

skapsinformation. Där föreskrivs bl.a. att dokument, mikroskrift och

 

maskinläsbara medier som används för att bevara räkenskapsinformation

 

ska vara varaktiga och lätt åtkomliga och att de ska bevaras fram till och

 

med det sjunde året efter utgången av det kalenderår då räkenskapsåret

 

avslutades (7 kap. 2 § första stycket).

 

Det finns sålunda genom reglerna i bokföringslagen en omfattande

 

skyldighet för elhandelsföretagen att bevara information under en tid som

 

överstiger de fem år som krävs enligt artikel 40.1 i elmarknadsdirektivet.

 

Den räkenskapsinformation som ska bevaras måste också i betydande

 

utsträckning antas svara mot de uppgifter som anges i artikel 40.2 i

 

direktivet, dvs. information om relevanta transaktioner, såsom regler om

 

löptid, tillhandahållande och fullgörande samt information om mängd,

 

datum och tider för verkställande, transaktionspriser och metoder för att

 

identifiera den berörda grossisten liksom specificerad information om

 

alla elleveransavtal och elderivat som inte fullgjorts. Det är emellertid

 

tveksamt om det på detta sätt säkerställs att ett elhandelsföretag bevarar

 

samtliga de uppgifter som anges i direktivet. Det kan exempelvis inte

 

utan vidare förutsättas att uppgifterna har särskild betydelse för att belysa

 

verksamhetens ekonomiska förhållanden eller är av betydelse för att det

 

ska gå att följa och förstå de enskilda bokföringsposternas behandling i

 

bokföringen.

 

Det kan vidare bli aktuellt att anpassa kraven i enlighet med sådana

 

riktlinjer som Europeiska kommissionen får anta enligt artikel 40.4 i

 

fråga om metoder och villkor för bevarande av information, liksom form

 

och innehåll när det gäller de uppgifter som ska bevaras.

 

 

44

Det finns mot denna bakgrund behov av att kunna införa nya Prop. 2011/12:77 bestämmelser, dock endast som ett komplement till den reglering som

redan finns i bokföringslagen. Behovet tillgodoses enklast genom att det införs en möjlighet för regeringen eller den myndighet som regeringen bestämmer att meddela föreskrifter om skyldighet för elleverantörer att dokumentera och bevara uppgifter om leveransavtal och derivat- instrument, inklusive information om transaktioner som gäller sådana avtal eller instrument. Regeringen föreslår att det nya normgivnings- bemyndigandet införs i 12 kap. 15 § ellagen (1997:897).

Skyldigheten att hålla informationen tillgänglig

I bokföringslagen föreskrivs ingen skyldighet att hålla räkenskaps- information tillgänglig för myndigheter. Nätmyndighetens nuvarande möjlighet att på begäran få del av sådan information är i nuläget begränsad. Av 12 kap. 2 § första stycket ellagen framgår att en tillsyns- myndighet har rätt att på begäran få de upplysningar och ta del av de handlingar som behövs för tillsynen. Nätmyndighetens tillsyn enligt ellagen omfattar dock främst nätföretagen. Utrymmet för att inom ramen för den tillsyn som riktar sig mot elhandelsföretagen begära att få ta del av räkenskapsinformation är relativt litet. Det finns inte heller några bestämmelser som säkerställer att informationen hålls tillgänglig för EU- kommissionen i enlighet med vad som stadgas i artikel 40.1 i elmarknadsdirektivet.

Mot denna bakgrund bör det vara möjligt för regeringen eller den

 

myndighet som regeringen bestämmer att meddela föreskrifter om

 

skyldighet för elleverantörer att på begäran lämna uppgifter om leverans-

 

avtal och derivatinstrument till en svensk myndighet eller Europeiska

 

kommissionen.

 

Finansinspektionen har berört frågor om skyldigheten för inspektionen

 

att lämna uppgifter till behöriga myndigheter enligt el- respektive

 

gasmarknadsdirektivet. Det saknas dock underlag för att ta upp spörs-

 

målet inom ramen för detta lagstiftningsärende.

 

Bestämmelser på naturgasområdet

 

Även i artikel 44 i gasmarknadsdirektivet finns bestämmelser om

 

bevarande av information. Kraven gäller gashandelsföretag och överens-

 

stämmer i övrigt med det som föreskrivs i fråga om elhandelsföretag i

 

artikel 40 i elmarknadsdirektivet. De överväganden som redovisats ovan

 

när det gäller företag på elmarknaden är därför i allt väsentligt relevanta

 

även på naturgasområdet (jfr även SOU 2010:30 s. 399–401 och prop.

 

2010/11:70 s. 162 f.). Det kan sålunda bli aktuellt att ställa krav på

 

naturgasleverantörer utöver vad som stadgas i bokföringslagen.

 

Tillsynsmyndighetens möjlighet att ta del av handlingar enligt 10 kap.

 

2 § naturgaslagen (2005:403) är inte tillräckligt omfattande för att säker-

 

ställa efterlevnaden av kraven i artikel 44 i gasmarknadsdirektivet.

 

Det bör därför införas en möjlighet för regeringen eller den myndighet

 

som regeringen bestämmer att meddela föreskrifter om skyldighet för

 

naturgasleverantörer att dokumentera och bevara uppgifter om leverans-

45

 

avtal, derivatinstrument och transaktioner som

gäller sådana avtal eller Prop. 2011/12:77

instrument

samt att på begäran lämna sådana

uppgifter till en svensk

myndighet

eller Europeiska kommissionen. Regeringen föreslår att ett

sådant normgivningsbemyndigande införs i 10 kap. 13 § naturgaslagen.

10 Ikraftträdande

Regeringens förslag: Lagändringarna ska träda i kraft den 1 juli 2012.

Promemorians förslag: Överensstämmer med regeringens.

Remissinstanserna: Förvaltningsrätten i Linköping har inte funnit någon närmare förklaring i promemorian till varför ikraftträdandet inte kan avvaktas till den 1 januari 2013. Övriga remissinstanser har inte berört frågan särskilt.

Skälen för regeringens förslag: Lagändringarna bör träda i kraft så snart som möjligt med hänsyn till att direktiven skulle ha varit genom- förda senast den 3 mars 2011.

Vissa frågor om övergångsbestämmelser behandlas i avsnitt 5 och 8.4.

11 Konsekvensanalys

11.1Inledning

I propositionen presenteras förslag till kompletterande åtgärder som är nödvändiga för ett fullständigt genomförande av det tredje inre marknadspaketet för el och naturgas. Förslagen påverkar främst de enskilda el- och naturgasföretagen och i viss mån Energimarknads- inspektionen.

Företagsgrupper som berörs är elleverantörer och elnätsföretag samt gashandelsföretag, transmissionsnätsoperatörer och innehavare av lagrings- och förgasningsanläggningar.

11.2Företagen på elmarknaden

Företagen

På den svenska elmarknaden verkar ca 120 elhandelsföretag och ca 170 elnätsföretag. Av elhandelsföretagen är 6 stora företag, 12 medelstora företag och ungefär 100 småföretag. Av elnätsföretagen är 4 stora före- tag, 9 medelstora företag och ca 160 småföretag.

46

Övervakningsplan för samriskföretag

Prop. 2011/12:77

Regeringen föreslår att vissa samriskföretag ska vara skyldiga att

 

upprätta en övervakningsplan. Några sådana samriskföretag finns i

 

nuläget inte i Sverige. Det finns inte heller anledning att anta att ett

 

sådant företag kommer att inrättas inom överskådlig tid. Förslaget kan

 

därför inte antas ha några kostnadsmässiga konsekvenser för företagen på

 

den svenska elmarknaden.

 

Villkor för tillträde till elnät

 

De kostnader som uppkommer för elnätsföretagen genom förhands-

 

regleringen av villkoren för tillträde till en ledning eller ett ledningsnät

 

måste antas vara små. I praktiken kommer företagen att kunna fullgöra

 

sina skyldigheter i detta avseende genom att lämna in utkast till standard-

 

avtal till Energimarknadsinspektionen för granskning. Enligt de uppgifter

 

som finns i databasen Malin har företag uppgivit att kostnaderna för att

 

göra jämförbara anmälningar uppgår till 200–400 kr per tillfälle.

 

Skyldighet att bevara information

 

I propositionen föreslås att regelverket kompletteras med föreskrifter om

 

skyldigheter för elleverantörer att bevara viss information om leverans-

 

avtal och derivatinstrument och göra informationen tillgänglig för

 

svenska nationella myndigheter samt EU-kommissionen. Kommissionen

 

kommer att utfärda närmare riktlinjer om vilken information som ska

 

bevaras och i vilket format den ska tillhandahållas. Därför föreslås ett

 

bemyndigande för regeringen, eller den myndighet regeringen

 

bestämmer, att utfärda närmare föreskrifter på området. Först i samband

 

med att sådana föreskrifter tas fram finns möjlighet att närmare bedöma

 

konsekvenserna för företagen.

 

11.3

Naturgasföretagen

Företagen

 

På den svenska naturgasmarknaden verkar ett tiotal företag av begränsad storlek.

Övervakningsplan för samriskföretag

Inte heller på naturgasmarknaden finns anledning att anta att det i Sverige inom överblickbar tid kommer att finnas samriskföretag som är skyldiga att upprätta en övervakningsplan enligt de föreslagna bestämmelserna.

47

Tillträde till förgasningsanläggning Prop. 2011/12:77

När det gäller förslagen till förhandsreglering av villkoren för tillträde till förgasningsanläggningar gäller följande. Det finns i dagsläget inte några sådana anläggningar som är anslutna till det svenska naturgasnätet. Av definitionen i 1 kap. 5 § naturgaslagen (2005:403) följer att detta är en förutsättning för att anläggningen ska betraktas som en förgasnings- anläggning enligt naturgaslagen. Därmed uppkommer inte i nuläget några konsekvenser till följd av bestämmelserna om förhandsreglering för de företag som i dag innehar förgasningsanläggningar.

Det finns planer på att bygga nya förgasningsanläggningar i Sverige. Om någon eller några av dessa anläggningar ansluts till naturgasnätet, kommer innehavaren att behöva ansöka om godkännande av tarifferna för tillträde. De aktuella projekten befinner sig emellertid inte på ett sådant stadium att det varit möjligt att inom ramen för det aktuella lagstiftningsärendet bedöma vilka kostnader förhandsprövningen kan medföra för de berörda företagen.

Åtskillnad av naturgaslagring

Det finns endast en lagringsanläggning i Sverige. Den har nyligen förvärvats av Swedegas AB. Det bolaget ingår inte i något koncern- förhållande med företag som bedriver produktion av eller handel med naturgas. Swedegas AB kommer därför inte att behöva några åtgärder med anledning av de nya bestämmelserna om funktionell åtskillnad.

För förgasningsanläggningar föreslås att åtskillnadskraven utgår. Detta ger inte upphov till några konsekvenser.

Förbud mot att röja uppgifter

I nuläget finns det i Sverige endast ett företag, Swedegas AB, som berörs av kravet på konfidentiell behandling av kommersiellt känsliga uppgifter. De kostnader som uppkommer för Swedegas AB får antas vara knutna främst till behovet av att se över befintliga rutiner för hanteringen av viss information. Det bör i sammanhanget noteras att Swedegas AB enligt 3 kap. 9 § naturgaslagen i dess lydelse före den 1 augusti 2011 var skyldigt att upprätta en övervakningsplan med åtgärder som skulle vidtas för att motverka diskriminerande beteende gentemot övriga aktörer på naturgasmarknaden. Av övervakningsplanen skulle bl.a. framgå på vilket sätt företagets styrfunktioner och IT-system hindrade icke-behöriga anställda vid överföringsverksamheten eller annan verksamhet inom koncernen tillgång till kommersiellt känsliga uppgifter och information i verksamheten såvida inte samma uppgifter och information redan var tillgänglig på icke-diskriminerande sätt till tredje part (7 § Statens energimyndighets föreskrifter och allmänna råd om skyldigheter för den som bedriver överföringsverksamhet avseende innehållet i över- vakningsplanen och offentliggörandet av den årliga rapporten enligt 3 kap. 9 § naturgaslagen [STEMFS 2006:6]).

Kostnaderna måste mot denna bakgrund antas vara mycket begränsade och i huvudsak av engångskaraktär.

48

Offentliggörande av information

Prop. 2011/12:77

När det gäller föreskrifter om skyldigheter för transmissionsnäts-

 

operatörer samt innehavare av lager- och förgasningsanläggningar att

 

offentliggöra information som har betydelse för naturgasmarknadens

 

funktion, kommer de konsekvenser som kan uppkomma att behandlas i

 

samband med att sådana föreskrifter tas fram.

 

Ny naturgasinfrastruktur

 

Regeringen föreslår att Energimarknadsinspektionen ska fastställa villkor

 

för hanteringen av kapacitet innan ett undantag enligt 9 kap. naturgas-

 

lagen beviljas. Sådana undantag innebär att ny naturgasinfrastruktur eller

 

utökad kapacitet i befintlig sådan inte omfattas av bestämmelser om

 

tredjepartstillträde. Syftet med villkoren är att i viss mån ersätta de regler

 

för tredjepartstillträde som annars hade varit gällande. En ansökan om

 

undantag är någonting som ett naturgasföretag gör frivilligt och i eget

 

intresse.

 

De företag som ansöker om undantag kommer att få göra sina villkor

 

för kapacitetshantering till föremål för Energimarknadsinspektionens

 

förhandsprövning. Det går inte att planera och genomföra ett nytt natur-

 

gasprojekt utan att kapacitetsbehovet har analyserats. En ansökan om

 

undantag innebär i sig viss administration. Det finns i dag inte något

 

jämförbart förfarande som kan tjäna som grund för en närmare bedöm-

 

ning av kostnaderna för företaget. Den tillkommande administration som

 

uppkommer i samband med förhandsprövningen av villkoren för

 

kapacitetshantering bedöms dock bli begränsad och endast uppstå vid

 

enstaka tillfällen.

 

Skyldighet att bevara information

 

När det gäller naturgasleverantörernas skyldighet att bevara viss

 

information och hålla den tillgänglig måste frågan om konsekvenser

 

bedömas på samma sätt som när det gäller motsvarande krav på

 

elleverantörer. Först i samband med att skyldigheten regleras i förord-

 

ning eller myndighetsföreskrifter finns möjlighet att närmare bedöma

 

konsekvenserna för företagen.

 

11.4 Energimarknadsinspektionen

Villkor för tillträde till elnät

 

I propositionen föreslås att Energimarknadsinspektionen ska förhands-

 

granska de metoder som nätföretagen använder för att utforma villkoren

 

för tillträde till en ledning eller ett ledningsnät. I praktiken kommer detta

 

att innebära att inspektionen granskar de standardvillkor nätföretagen

 

avser att använda i sina avtal. Uppgiften underlättas av att sådana villkor

 

redan i dag omfattas av Energimarknadsinspektionens tillsyn. Energi-

 

marknadsinspektionen har i sitt remissvar poängterat att den nya

 

bestämmelsen inledningsvis kommer att kräva att inte obetydliga resurser

49

 

tas i anspråk både för bedömning och analys och för administration. Prop. 2011/12:77 Även sedan hänsyn tagits till sådana kostnader gör regeringen dock

bedömningen att den nya uppgiften kan hanteras inom befintliga budgetramar.

Tillträde till förgasningsanläggning

Regeringen föreslår en ordning med förhandsprövning av tariffer för tillträde till förgasningsanläggningar. Som framgått i avsnitt 11.3 finns det i Sverige i dag inte några förgasningsanläggningar som berörs av den nya regleringen. Därmed uppstår inte i nuläget några konsekvenser i Energimarknadsinspektionens tillsynsverksamhet till följd av förslaget.

Det finns planer på att bygga nya förgasningsanläggningar i Sverige. Om någon eller några av dessa ansluts till naturgasnätet kommer det att bli nödvändigt att granska tarifferna för tillträde i enlighet med de före- slagna bestämmelserna. På detta stadium saknas emellertid underlag för att bedöma eventuella konsekvenser för Energimarknadsinspektionens verksamhet.

Ny naturgasinfrastruktur

De nya bestämmelserna om undantag för ny naturgasinfrastruktur bedöms inte medföra några nya kostnader för Energimarknadsinspek- tionen. Det åligger redan enligt gällande bestämmelser inspektionen att utreda ärenden om undantag inför regeringens prövning. Ansökningar om undantag torde endast aktualiseras i enstaka fall och i propositionen lämnas även förslag till vad företagen har att iaktta vid sin kapacitets- hantering.

Normgivningsbemyndiganden

Det föreslås bemyndiganden för regeringen, eller den myndighet rege- ringen bestämmer att meddela föreskrifter om bevarande av information och skyldigheter för transmissionsnätsoperatörer samt innehavare av lager och förgasningsanläggningar att offentliggöra information som har betydelse för naturgasmarknadens funktion. Frågan om huruvida ett bemyndigande att meddela föreskrifter på området medför ett ökat resursbehov för Energimarknadsinspektionen kommer att behandlas i samband med att ett sådant bemyndigande meddelas.

11.5De allmänna förvaltningsdomstolarna

Energimarknadsinspektionens beslut i frågor om tillträde till elnät kommer att kunna överklagas hos allmän förvaltningsdomstol. Det framstår som sannolikt att antalet överklaganden kommer att bli mycket begränsat.

När det gäller kravet på förhandsprövning av villkoren för tillträde till förgasningsanläggning saknas det anledning att anta att Energi-

50

marknadsinspektionen kommer att behöva fatta beslut i något sådant Prop. 2011/12:77 ärende inom överskådlig framtid.

Förvaltningsrätten i Linköping har anfört att frågan om resurser bör bedömas utifrån ett helhetsperspektiv i stället för enbart utifrån de förslag som presenterats i promemorian. Inom ramen för den konsekvens- bedömning som kan göras i anslutning till förslagen i propositionen saknas dock förutsättningar för att göra en sådan helhetsbedömning. Regeringen konstaterar att några ytterligare resurser inte behöver tillföras de allmänna förvaltningsdomstolarna med anledning av förslagen i propositionen.

51

12

Författningskommentar

Prop. 2011/12:77

12.1Förslaget till lag om ändring i ellagen (1997:857)

3 kap.

17 b § Ett samriskföretag ska upprätta och genomföra en över- vakningsplan, om

1.företaget har bildats för att genomföra ett samarbete som syftar till att integrera marknader för el i Norden och Europeiska unionen, och

2.det bland de företag som har bildat samriskföretaget finns nätföretag som ingår i samma koncern som företag som, utan att vara produktionsföretag som avses i 1 i §, bedriver produktion av eller handel med el.

Av övervakningsplanen ska det framgå vilka åtgärder som företaget ska vidta för att förhindra diskriminerande och konkurrens- begränsande beteende gentemot övriga aktörer på elmarknaden. I planen ska särskilt anges de särskilda skyldigheter som företagets anställda har för att förhindra detta.

Övervakningsplanen ska godkännas av byrån för samarbete mellan energitillsynsmyndigheter. Planen ska ges in till byrån för prövning av sådant godkännande.

I paragrafen, som är ny, finns bestämmelser som har tillkommit med anledning av artikel 6 i Europaparlamentets och rådets direktiv 2009/72/EG av den 13 juli 2009 om gemensamma regler för den inre marknaden för el och om upphävande av direktiv 2003/54/EG (elmark- nadsdirektivet). Artikeln innehåller föreskrifter om främjande av regionalt samarbete i syfte att integrera medlemsstaternas inhemska marknader på en eller flera regionala nivåer, som ett första steg mot skapandet av en helt liberaliserad inre marknad.

I artikel 6.4 finns krav som gäller ett samriskföretag (”joint undertaking”) som har inrättats i syfte att genomföra samarbetet. Om vertikalt integrerade systemansvariga för överföringssystemen deltar i ett sådant samriskföretag ska detta upprätta och genomföra en över- vakningsplan med åtgärder som ska vidtas för att förhindra diskrimi- nerande och konkurrensbegränsande beteende. I Sverige får den system- ansvarige för överföringssystemet (stamnätsföretaget) inte vara vertikalt integrerad (se 1 f–1 j §§). Det kan dock komma i fråga att ett i Sverige inrättat samriskföretag har ett vertikalt integrerat utländskt nätföretag som delägare.

Kravet att upprätta en övervakningsplan framgår av första stycket i paragrafen. I andra stycket finns bestämmelser om planens innehåll.

Av tredje stycket framgår att övervakningsplanen ska godkännas av byrån för samarbete mellan energitillsynsmyndigheter (ACER).

Övervägandena finns i avsnitt 4.2. Paragrafen har utformats med beaktande av Lagrådets förslag.

52

4 kap.

Prop. 2011/12:77

1 a § En nätkoncessionshavare får inte ingå avtal om tillträde till en ledning eller ett ledningsnät förrän de metoder som har använts för att utforma avtalsvillkoren har prövats av nätmyndigheten. Nätmyndig- heten ska godkänna metoderna, om de kan antas leda till att avtalen uppfyller de krav som anges i 1 § första stycket. Prövningen ska dock inte omfatta metoder för att utforma avgifter för överföring av el och för anslutning.

Om nätmyndigheten inte godkänner de metoder som föreslås i en ansökan, ska myndigheten i beslutet ange de metoder som i stället ska tillämpas.

Beslut enligt första och andra styckena gäller omedelbart. Nätmyndigheten ska delge beslutet enligt 49 § första stycket 1 och andra stycket delgivningslagen (2010:1932).

Paragrafen, som är ny, har tillkommit med anledning av artikel 37.6 a och c i elmarknadsdirektivet, där det stadgas att tillsynsmyndigheterna ska ansvara för att i förväg fastställa eller godkänna åtminstone metoder för att beräkna eller fastställa villkoren dels för anslutning och tillträde till nationella nät, dels för tillträde till gränsöverskridande infrastruktur.

När det gäller avgifter för överföring av el och för tillträde till ledningar och ledningsnät finns redan en ordning för förhandsprövning enligt 5 kap. Med hänsyn till elmarknadsdirektivets krav föreslås att regelverket kompletteras med en förhandsprövning av övriga villkor för tillträde till ledningsnäten.

I normalfallet kan en sådan förhandsprövning ske genom att nätmyndigheten granskar de standardvillkor som nätföretagen använder för att utforma avtalen med enskilda kunder. I nätmyndighetens tillsyn ingår också att övervaka att villkoren i de avtal som ingås uppfyller kraven i 1 § första stycket. Förhandsprövningen ersätter inte efter- handstillsynen utan ska ses som ett komplement.

Paragrafen har utformats på i huvudsak samma sätt som 8 kap. 4 a § andra och tredje styckena. Bestämmelsen i andra stycket har 6 kap. 5 § andra stycket naturgaslagen (2005:403) som förebild.

Övervägandena finns i avsnitt 5.1. Paragrafen har utformats med beaktande av Lagrådets förslag.

12 kap.

15 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om skyldighet för elleverantörer att dokumentera och bevara uppgifter om leveransavtal, derivatinstrument och transaktioner som gäller sådana avtal eller instrument samt att på begäran lämna sådana uppgifter till en svensk myndighet eller Europeiska kommissionen.

I paragrafen, som är ny, finns ett bemyndigande för regeringen eller den myndighet som regeringen bestämmer att meddela föreskrifter om

skyldighet för elleverantörer att bevara information om leveransavtal och

53

derivatinstrument och att göra informationen tillgänglig dels för svenska Prop. 2011/12:77 nationella myndigheter, dels för Europeiska kommissionen. Bestämmel-

sen har tillkommit med anledning av artikel 40 i elmarknadsdirektivet. Med derivatinstrument avses ett finansiellt instrument vars värde beror på en annan, underliggande tillgång. Ett elderivat är sålunda ett derivat- kontrakt som har el som underliggande tillgång (se prop. 2006/07:115

s.261).

Övervägandena finns i avsnitt 9.

13 kap.

5 § Beslut av nätmyndigheten enligt 2 kap. 18–20 §§, 3 kap. 3, 6–8, 9 b, 11, 14 och 15 §§, 4 kap. 1 a, 6, 7 och 10 §§, 5 kap. 3, 11–13, 15–17, 26 och 27 §§, 8 kap. 4 a § samt 12 kap. 8 och 11 §§, beslut av en tillsynsmyndighet enligt 12 kap. 2–4 §§ samt beslut av den system- ansvariga myndigheten om ersättning till den som enligt 8 kap. 2 § beordrats öka eller minska produktionen av el får överklagas till allmän förvaltningsdomstol. Prövningstillstånd krävs vid över- klagande till kammarrätt.

Regeringen meddelar föreskrifter om överklagande till regeringen av andra beslut enligt denna lag eller enligt föreskrifter som har meddelats med stöd av lagen.

Första stycket har ändrats för att nätmyndighetens beslut enligt 4 kap. 1 a § ska kunna överklagas till allmän förvaltningsdomstol.

Ändringarna i andra stycket innebär att det tydligt markeras dels att regeringen med stöd av restkompetensen kan meddela föreskrifter om överklagande till regeringen, dels att sådana föreskrifter om över- klagande som regeringen meddelar inte kan avse överklagande till domstol (jfr 11 kap. 2 § regeringsformen).

Övervägandena finns i avsnitt 5.1.

Ikraftträdande- och övergångsbestämmelser

1.Denna lag träder i kraft den 1 juli 2012.

2.De nya bestämmelserna i 4 kap. 1 a § tillämpas dock inte på

a)sådana avtal om tillträde till en ledning eller ett ledningsnät som en nätkoncessionshavare ingår före den 1 januari 2013, eller

b)avtal som nätkoncessionshavaren ingår under tiden från det att en ansökan om metodprövning har lämnats in till nätmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan har lämnats in före utgången av augusti 2012.

Av första punkten framgår att de nya bestämmelserna träder i kraft den 1 juli 2012.

I andra punkten regleras de nya bestämmelserna i 4 kap. 1 a § om godkännande av metoder för att utforma avtalsvillkor. De avtal som ingåtts före den 1 januari 2013 omfattas inte av den nya regleringen och

fortsätter alltså att gälla oförändrade under sin återstående giltighetstid.

54

För att säkerställa att en nätkoncessionshavare kan få frågan prövad Prop. 2011/12:77 innan den nya regleringen börjar tillämpas på ingångna avtal föreskrivs

vidare att de nya bestämmelserna inte heller ska tillämpas i fråga om avtal som nätkoncessionshavaren ingår under tiden från det att en ansökan om godkännande har lämnats in till nätmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan lämnas in före utgången av augusti 2012.

Övervägandena finns i avsnitt 5.1. Övergångsbestämmelserna har utformats i linje med Lagrådets förslag.

12.2Förslaget till lag om ändring i naturgaslagen (2005:403)

1 kap.

6 a § Med transmission avses i denna lag överföring av naturgas i en högtrycksledning eller ett nät som i huvudsak består av högtrycks- ledningar med undantag för högtrycksledning som huvudsakligen används i samband med lokal distribution av naturgas.

I paragrafen, som är ny, införs termen transmission i lagen. Definitionen av transmission svarar i huvudsak mot definitionen av ”överföring” i artikel 2.3 i Europaparlamentets och rådets direktiv 2009/73/EG av den 13 juli 2009 om gemensamma regler för den inre marknaden för naturgas och om upphävande av direktiv 2003/55/EG (gasmarknadsdirektivet). Till skillnad från den definitionen görs inte undantag för transport av naturgas genom tidigare led i rörledningsnätet. Några sådana led finns inte i det svenska naturgasnätet (jfr artikel 2.2 i gasmarknadsdirektivet).

Den nya termen används i 7 a §, som en del av definitionen av transmissionsnätsoperatör, och i 3 kap. 2 f §.

7 a § Med transmissionsnätsoperatör avses i denna lag den som bedriver transmission.

Definitionen av transmissionsnätsoperatör har fått en ny lydelse med anledning av att termen transmission har införts i lagen. Den är dock till sitt sakliga innehåll oförändrad.

3 kap.

2 f § Om en transmissionsnätsoperatör bedriver även annan verk- samhet än transmission, ska operatören säkerställa att kommersiellt känsliga uppgifter om transmissionen inte görs tillgängliga för de delar av företaget som bedriver annan verksamhet.

Om en transmissionsnätsoperatör ingår i en koncern, ska operatören säkerställa att kommersiellt känsliga uppgifter om transmissionen inte görs tillgängliga för företag i koncernen som bedriver annan verksam-

het.

55

Första och andra styckena hindrar inte att kommersiellt känsliga Prop. 2011/12:77 uppgifter om transmission görs tillgängliga för företag eller delar av

företag som bedriver annan verksamhet, om det är nödvändigt för att genomföra en affärstransaktion.

I paragrafen, som är ny, finns föreskrifter om behandlingen av kommer- siellt känsliga uppgifter inom en transmissionsverksamhet. Bestämmel- serna har tillkommit med anledning av artikel 16.1 i gasmarknadsdirek- tivet.

Bestämmelsen i första stycket gäller det fallet att ett företag som bedriver transmission även bedriver annan verksamhet. De delar av företaget som inte ägnar sig åt transmission ska i så fall inte få tillgång till kommersiellt känsliga uppgifter om transmissionen. Med sådana uppgifter avses uppgifter i transmissionsverksamheten som inte är allmänt kända och utgör en kommersiell fördel för någon utomstående, i synnerhet företag som bedriver produktion av eller handel med naturgas.

I andra stycket finns en bestämmelse som gäller en transmissionsnäts- operatör som ingår i en koncern. En sådan transmissionsnätsoperatör måste säkerställa att kommersiellt känsliga uppgifter inte görs tillgäng- liga för företag i koncernen som inte själva bedriver transmission.

Av tredje stycket framgår att det får göras undantag från kraven i första och andra styckena om det är nödvändigt att göra de kommersiellt känsliga uppgifterna tillgängliga för att genomföra en affärstransaktion.

Övervägandena finns i avsnitt 7.2. Paragrafen har utformats med beaktande av Lagrådets förslag.

10 a § Ett samriskföretag ska upprätta och genomföra en över- vakningsplan, om

1.företaget har bildats för att genomföra ett samarbete som syftar till att integrera marknader för naturgas i Norden och Europeiska unionen, och

2.det bland de företag som har bildat samriskföretaget finns en transmissionsnätsoperatör som ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas.

Av övervakningsplanen ska det framgå vilka åtgärder som företaget ska vidta för att förhindra diskriminerande och konkurrens- begränsande beteende gentemot övriga aktörer på naturgasmarknaden. I planen ska dessutom anges de särskilda skyldigheter som företagets anställda har för att förhindra detta.

Övervakningsplanen ska godkännas av byrån för samarbete mellan energitillsynsmyndigheter. Planen ska ges in till byrån för prövning av sådant godkännande.

I paragrafen, som är ny, finns bestämmelser som har tillkommit med

 

anledning av artikel 7 i gasmarknadsdirektivet. Artikeln innehåller före-

 

skrifter om främjande av regionalt samarbete i syfte att integrera

 

medlemsstaternas inhemska marknader på en eller flera regionala nivåer,

 

som ett första steg mot skapandet av en helt liberaliserad inre marknad.

 

I artikel 7.4 finns krav som gäller ett samriskföretag (”joint

 

undertaking”) som har inrättats i syfte att genomföra samarbetet. Om

56

vertikalt integrerade systemansvariga för överföringssystemen deltar i ett Prop. 2011/12:77 sådant samriskföretag, ska detta upprätta och genomföra en över-

vakningsplan med åtgärder som ska vidtas för att förhindra diskrimi- nerande och konkurrensbegränsande beteende. I Sverige får en system- ansvarig för överföringssystemet (transmissionsnätsoperatör) inte vara vertikalt integrerad (se 2–2 d §§). Det kan dock komma i fråga att ett i Sverige inrättat samriskföretag har en vertikalt integrerad utländsk transmissionsnätsoperatör som delägare.

Kravet att upprätta en övervakningsplan framgår av första stycket i paragrafen. I andra stycket finns bestämmelser om planens innehåll.

Av tredje stycket framgår att övervakningsplanen ska godkännas av byrån för samarbete mellan energitillsynsmyndigheter (ACER).

Övervägandena finns i avsnitt 4.3. Paragrafen har utformats med

beaktande av Lagrådets förslag.

 

12 § Regeringen eller, efter regeringens bemyndigande, tillsyns-

 

myndigheten får meddela föreskrifter om skyldighet för en

 

transmissionsnätsoperatör att offentliggöra information som har

 

betydelse för naturgasmarknadens funktion.

 

I paragrafen, som är ny, finns ett bemyndigande för regeringen eller, efter

 

regeringens bemyndigande, tillsynsmyndigheten att meddela föreskrifter

 

om skyldighet för en transmissionsnätsoperatör att offentliggöra

 

information som har betydelse för naturgasmarknadens funktion.

 

Bestämmelsen har tillkommit med anledning av artikel 16.3 i gasmark-

 

nadsdirektivet.

 

Övervägandena finns i avsnitt 7.3.

 

4 kap.

 

2 § Ett företag som innehar en lagringsanläggning får inte bedriva

 

produktion av eller handel med naturgas. Om ett sådant företag ingår

 

i en koncern, ska dess organisation och beslutsordning vara skild från

 

företag som bedriver produktion av eller handel med naturgas.

 

En styrelseledamot, verkställande direktör eller firmatecknare i ett

 

företag som innehar en lagringsanläggning får inte samtidigt vara

 

styrelseledamot, verkställande direktör eller firmatecknare i ett

 

företag som bedriver produktion av eller handel med naturgas.

 

Paragrafen har till en början ändrats på så sätt att den juridiska och

 

personella åtskillnaden har utvidgats till att gälla även i fråga om

 

produktion av naturgas. Däremot inskränks kravet på åtskillnad på så sätt

 

att det inte längre ska gälla innehavare av förgasningsanläggningar.

 

I första stycket har vidare en ny mening tillkommit, där det anges vilka

 

övergripande krav på funktionell åtskillnad som ställs på ett företag som

 

innehar en lagringsanläggning och som ingår i en koncern. Bestämmel-

 

sen ska ses mot bakgrund av artikel 15.2 i gasmarknadsdirektivet. Ett

 

exempel på vad som kan vara av betydelse för bedömningen av om

 

åtskillnadskravet är uppfyllt är förekomsten av koncerngemensamma

57

 

funktioner, såsom ekonomi- och personaladministration. Sådana funk- Prop. 2011/12:77 tioner är inte redan i sig otillbörliga, men det är väsentligt hur de är

organiserade. Ett annat relevant förhållande är rörligheten av personer i ledande befattningar inom koncernen.

Bestämmelsen i andra stycket bör uppfattas som en precisering av kravet på funktionell åtskillnad.

Övervägandena finns i avsnitt 6.1. Paragrafen har utformats i enlighet med Lagrådets förslag.

2 a § Ett företag som innehar en lagringsanläggning och ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas får inte bevilja anställda i ledande ställning löner eller andra förmåner som grundar sig på resultatet i de delar av koncernen som bedriver sådan produktion eller handel.

Bestämmelsen i paragrafen, som är ny, syftar till att säkerställa att anställda i ledande ställning hos ett företag som innehar en lagrings- anläggning inte har intresse av att gynna andra företag inom samma koncern, vilka bedriver produktion av eller handel med naturgas på den konkurrensutsatta marknaden. Bestämmelsen ska ses mot bakgrund av artikel 15.2 b i gasmarknadsdirektivet och utgör en konkretisering av det åtskillnadskrav som ställs upp i 2 §.

Med anställda i ledande ställning avses framför allt den verkställande direktören men även andra personer som ansvarar för ledningen av före- taget.

Övervägandena finns i avsnitt 6.2.

2 b § Ett företag som innehar en lagringsanläggning och ingår i en koncern där ett annat företag bedriver produktion av eller handel med naturgas ska, tillsammans med sitt moderföretag, se till att det har en i förhållande till övriga företag i koncernen faktisk och självständig beslutanderätt när det gäller de tillgångar som behövs för att trygga drift, underhåll och utbyggnad av anläggningen.

Första stycket hindrar inte att moderföretaget har sådan insyn och utövar sådan styrning av anläggningsföretaget som krävs för att säker- ställa en rimlig avkastning på de investeringar som gjorts i anlägg- ningsföretaget. Moderföretaget får dock inte ge instruktioner åt anläggningsföretaget om företagets löpande förvaltning eller beslut att bygga eller modernisera en lagringsanläggning, om inte instruk- tionerna avser åtgärder eller beslut som går utöver de ekonomiska ramar som fastställts av anläggningsföretagets bolagsstämma eller motsvarande organ.

Paragrafen är ny och innehåller bestämmelser som, när det gäller lagring av naturgas, syftar till att genomföra artikel 15.2 c i elmarknadsdirektivet i svensk rätt. Bestämmelserna i paragrafen innebär att kravet på åtskillnad inom en koncern som innehar en lagringsanläggning och samtidigt bedriver produktion av eller handel med naturgas preciseras när

58

det gäller beslutanderätten över tillgångar som används i lagrings-

Prop. 2011/12:77

verksamheten.

 

Enligt första stycket ska ett företag som innehar en lagringsanläggning

 

och ingår i en koncern, där ett annat företag bedriver produktion av eller

 

handel med naturgas, tillsammans med sitt moderföretag se till att det har

 

en i förhållande till övriga företag i koncernen faktisk och självständig

 

beslutanderätt när det gäller de tillgångar som behövs för att trygga drift,

 

underhåll och utbyggnad av anläggningen. Detta kan ske genom att

 

företaget ser till att självt äga de aktuella tillgångarna och förfoga över

 

dem utan att behöva ta otillbörlig hänsyn till andra företag i koncernen.

 

Det finns emellertid utrymme för att driva lagringsverksamheten med

 

utrustning som företaget innehar med nyttjanderätt. Ett företag som inne-

 

har en anläggning måste i så fall se till att exempelvis ett hyresavtal är så

 

utformat att kravet på faktisk beslutanderätt tillgodoses. Moderföretaget

 

får inte undanhålla rådighet över resurser i syfte att på det sättet utöva

 

kontroll över lagringsverksamheten.

 

Med faktisk beslutanderätt åsyftas bl.a. att de relevanta besluten ska

 

fattas inom företaget som innehar anläggningen. Det är inte förenligt med

 

kravet på sådan beslutanderätt att de enskilda besluten kräver formellt

 

eller informellt godkännande från andra delar av koncernen. Med faktisk

 

beslutanderätt när det gäller de tillgångar som behövs för att trygga drift,

 

underhåll och utbyggnad av anläggningen bör inte förstås ett krav på

 

fullständig rådighet över alla tillgångar som kommer till användning i

 

verksamheten. Vad som åsyftas är i stället att anläggningsföretaget ska

 

ha faktisk beslutanderätt i fråga om de tillgångar som företaget behöver

 

för att trygga verksamheten.

 

Av andra stycket första meningen framgår att bestämmelserna i första

 

stycket inte hindrar att moderföretaget har sådan insyn och utövar sådan

 

styrning som krävs för att säkerställa en rimlig avkastning på de investe-

 

ringar som gjorts i anläggningsföretaget. Bestämmelsen svarar mot vad

 

som anges i artikel 15.2 c andra meningen i gasmarknadsdirektivet. Det

 

ska framför allt vara möjligt för moderföretaget att genom bolags-

 

stämman eller motsvarande organ bestämma ekonomiska ramar för

 

dotterföretagets verksamhet.

 

I andra stycket andra meningen finns en bestämmelse som anger vissa

 

gränser för moderföretagets möjligheter att utöva styrning. Den har

 

tillkommit med hänsyn till vad som föreskrivs i artikel 15.2 c fjärde

 

meningen i gasmarknadsdirektivet. Ett moderföretags övervakning får

 

inte innebära att det ger instruktioner om den löpande förvaltningen eller

 

beslut att bygga eller modernisera en lagringsanläggning, om inte

 

instruktionerna avser åtgärder eller beslut som går utöver de ekonomiska

 

ramar som fastställts av anläggningsföretagets bolagsstämma eller

 

motsvarande organ. Instruktioner till ett dotterföretag lämnas främst

 

genom beslut av bolagsstämman. Att ett moderföretag inte får lämna

 

instruktioner i vissa frågor innebär att det är helt förhindrat att vid

 

stämman rösta för ett förslag som innehåller sådana instruktioner, även

 

om förslaget skulle ha lagts fram av en annan aktieägare. De ekonomiska

 

ramarna kan liknas vid en budget och innehålla sådant som krav på

 

avkastning och skuldsättningsnivåer.

 

Det bör betonas att bestämmelserna i andra stycket endast syftar till att

 

avgränsa området för den faktiska beslutanderätten för det företag som

59

innehar lagringsanläggningen. Vad som avses är sålunda situationer där

Prop. 2011/12:77

den faktiska beslutanderätten inte ska utgöra ett hinder för att ett moder-

 

företag utövar de rättigheter som följer av det associationsrättsliga regel-

 

verket. Det som sägs i andra stycket ger inte taget för sig en ägare några

 

förvaltningsrättigheter.

 

När det gäller begreppen moderföretag och dotterföretag kan ledning

 

hämtas i 1 kap. 11 och 12 §§ aktiebolagslagen (2005:551). Ett moder-

 

företag kan vara ett moderbolag enligt den aktiebolagsrättsliga lagstift-

 

ningen men även en annan juridisk person.

 

Övervägandena finns i avsnitt 6.3. Paragrafen har utformats i enlighet

 

med Lagrådets förslag.

 

2 c § Om ett företag som innehar en lagringsanläggning bedriver

 

även annan verksamhet än lagring av naturgas, ska företaget säker-

 

ställa att kommersiellt känsliga uppgifter om lagringen inte görs

 

tillgängliga för de delar av företaget som bedriver annan verksamhet.

 

Ett företag som innehar en lagringsanläggning och ingår i en

 

koncern ska säkerställa att kommersiellt känsliga uppgifter om

 

lagringen inte görs tillgängliga för företag i koncernen som bedriver

 

annan verksamhet.

 

Första och andra styckena hindrar inte att kommersiellt känsliga

 

uppgifter om lagringen görs tillgängliga för företag eller delar av

 

företag som bedriver annan verksamhet, om det är nödvändigt för att

 

genomföra en affärstransaktion.

 

I paragrafen, som är ny, finns föreskrifter om behandlingen av kommer-

 

siellt känsliga uppgifter inom ett företag eller en koncern som innehar en

 

lagringsanläggning. Bestämmelserna har tillkommit med anledning av

 

artikel 16.1 i gasmarknadsdirektivet.

 

Bestämmelsen i första stycket gäller det fallet att ett företag som inne-

 

har en lagringsanläggning bedriver även annan verksamhet än lagring av

 

naturgas. De delar av företaget som inte ägnar sig åt lagring ska i så fall

 

inte få tillgång till kommersiellt känsliga uppgifter om lagringen. Med

 

sådana uppgifter avses uppgifter i lagringsverksamheten som inte är

 

allmänt kända och utgör en kommersiell fördel för någon utomstående, i

 

synnerhet företag som bedriver produktion av eller handel med naturgas.

 

I andra stycket finns en bestämmelse som gäller ett företag som inne-

 

har en lagringsanläggning och ingår i en koncern. Ett sådant företag

 

måste säkerställa att kommersiellt känsliga uppgifter inte görs tillgäng-

 

liga för företag i koncernen som inte själva bedriver lagring av naturgas.

 

Av tredje stycket framgår att det får göras undantag från kraven i första

 

och andra styckena om det är nödvändigt att göra de kommersiellt

 

känsliga uppgifterna tillgängliga för att genomföra en affärstransaktion.

 

Övervägandena finns i avsnitt 7.2. Paragrafen har utformats i enlighet

 

med Lagrådets förslag.

 

2 d § Bestämmelserna i 2 c § om företag som innehar en lagrings-

 

anläggning och om lagring av naturgas gäller även företag som inne-

 

har en förgasningsanläggning och drift av en sådan anläggning.

60

Prop. 2011/12:77

Av paragrafen, som är ny, framgår att de krav på konfidentiell behand- ling av uppgifter som enligt 2 c § ställs på företag som innehar en lagringsanläggning har motsvarande tillämpning när det gäller företag som innehar en förgasningsanläggning.

7 § Ett företag som innehar en lagringsanläggning och ingår i samma koncern som ett företag som bedriver produktion av eller handel med naturgas ska upprätta en övervakningsplan och se till att planen följs.

Av övervakningsplanen ska det framgå vilka åtgärder som företaget

 

ska vidta för att motverka diskriminerande beteende gentemot övriga

 

aktörer på naturgasmarknaden. I planen ska anges de särskilda

 

skyldigheter som företagets anställda har för att motverka detta.

 

Regeringen eller, efter regeringens bemyndigande, tillsynsmyndig-

 

heten får meddela ytterligare föreskrifter om innehållet i över-

 

vakningsplanen.

 

Paragrafen, som är ny och behandlas i avsnitt 6.4, har tillkommit med

 

anledning av artikel 15.2 d i gasmarknadsdirektivet. Krav på över-

 

vakningsplan finns redan enligt 3 kap. 9 § när det gäller företag som

 

bedriver överföring av naturgas.

 

Paragrafen har utformats med beaktande av Lagrådets förslag.

 

8 § Den som är skyldig att upprätta en övervakningsplan enligt 7 §

 

ska årligen upprätta en rapport över de åtgärder som vidtagits.

 

Rapporten ska ges in till tillsynsmyndigheten och i samband med detta

 

offentliggöras av ingivaren.

 

Regeringen eller, efter regeringens bemyndigande, tillsynsmyndig-

 

heten får meddela ytterligare föreskrifter om offentliggörandet av den

 

årliga rapporten.

 

Paragrafen, som är ny och behandlas i avsnitt 6.4, har tillkommit med

 

anledning av artikel 15.2 d i gasmarknadsdirektivet. När det gäller före-

 

tag som bedriver överföring av naturgas finns liknande bestämmelser i

 

3 kap. 10 § andra och tredje styckena.

 

9 § Regeringen eller, efter regeringens bemyndigande, tillsyns-

 

myndigheten får meddela föreskrifter om undantag från de skyldig-

 

heter som följer av 2–2 b, 7 och 8 §§.

 

I paragrafen, som är ny och behandlas i avsnitt 6.5, finns ett bemyn-

 

digande för regeringen eller, efter regeringens bemyndigande, tillsyns-

 

myndigheten att meddela föreskrifter om undantag från kraven på

 

åtskillnad. Avsikten är främst att genom förordning eller myndighets-

 

föreskrifter kunna undanta lagringsanläggningar som inte är tekniskt eller

 

ekonomiskt nödvändiga för ett effektivt tillträde till systemet för leverans

 

till kunderna (jfr artikel 15.1 andra stycket i gasmarknadsdirektivet).

61

10 § Regeringen eller, efter regeringens bemyndigande, tillsyns- Prop. 2011/12:77 myndigheten får meddela föreskrifter om skyldighet för företag som

innehar en lagrings- eller förgasningsanläggning att offentliggöra information som har betydelse för naturgasmarknadens funktion.

I paragrafen, som är ny, finns ett bemyndigande för regeringen eller, efter regeringens bemyndigande, tillsynsmyndigheten att meddela föreskrifter om skyldighet för företag som innehar en lagrings- eller förgasnings- anläggning att offentliggöra information som har betydelse för naturgas- marknadens funktion. Bestämmelsen har tillkommit med anledning av artikel 16.3 i gasmarknadsdirektivet.

Övervägandena finns i avsnitt 7.3.

6 kap.

5 § Den som bedriver överföring av naturgas eller innehar en förgasningsanläggning får inte börja tillämpa sin avgift och övriga villkor för sådan anslutning som avses i 3 kap. 5 § eller sin tariff för överföring eller tillträde förrän de metoder som har använts för att utforma avgiften eller tariffen har godkänts av tillsynsmyndigheten. Godkännande ska lämnas, om metoderna kan antas leda till att avgiften eller tariffen uppfyller kraven på att den ska vara objektiv och icke-diskriminerande.

Om tillsynsmyndigheten inte godkänner de metoder som avses med en ansökan, ska myndigheten i beslutet ange de metoder som i stället ska tillämpas.

Beslut enligt första och andra styckena gäller omedelbart. Tillsynsmyndigheten ska delge sådana beslut enligt 49 § första stycket 1 och andra stycket delgivningslagen (2010:1932).

Första stycket har ändrats på så sätt att förhandsprövningen utvidgas till att omfatta även tariffer för tillträde till en förgasningsanläggning. Den som innehar en sådan anläggning får sålunda inte börja tillämpa sin tillträdestariff förrän tillsynsmyndigheten har godkänt de metoder som har använts för att utforma tariffen. Med tariff avses såväl avgifter som övriga villkor för överföring eller tillträde (jfr prop. 2004/05:62 s. 429). Kontrollen syftar till att säkerställa att tariffen är objektiv och icke- diskriminerande. Ändringen har skett mot bakgrund av de krav som finns i artikel 41.6 a i gasmarknadsdirektivet.

Inga ändringar föreslås i andra eller tredje stycket. Övervägandena finns i avsnitt 5.2.

9 kap.

1 § Den som har ansökt om koncession som avser byggande av en naturgasledning, en lagringsanläggning eller en förgasnings- anläggning får, om den berörda ledningen eller anläggningen är av större omfattning, beviljas undantag från skyldigheterna enligt

3 kap. 2–2 d, 5 och 6 §§, 4 kap. 5 och 6 §§, 6 kap. 1–3, 4 och 5 §§ och

62

7 kap. 5 § samt föreskrifter som har meddelats med stöd av 6 kap. Prop. 2011/12:77

3 a §.

Detsamma gäller den som har ansökt om koncession som avser ett väsentligt utökande av kapaciteten i en befintlig sådan ledning eller anläggning.

Ett beslut om undantag får avse hela eller en del av kapaciteten i den berörda ledningen eller anläggningen.

Paragrafen har ändrats för att svara mot kraven i artikel 36 i gasmark- nadsdirektivet.

I första stycket har ändringar gjorts när det gäller vilka skyldigheter ett undantag ska avse.

Inga ändringar föreslås i andra stycket.

Den nya lydelsen av tredje stycket innebär att ett undantag kan avse hela eller en del av kapaciteten i den berörda ledningen eller anlägg- ningen, oavsett om koncessionen avser byggandet av en ny anläggning eller ett väsentligt utökande av kapaciteten i en befintlig ledning eller anläggning.

Övervägandena finns i avsnitt 8.2.1. Paragrafen har utformats med beaktande av Lagrådets förslag.

3 a § Innan ett beslut om undantag meddelas ska villkor fastställas för hanteringen av kapacitet.

Villkoren ska säkerställa att

1.alla potentiella användare av ledningen eller anläggningen får möjlighet att anmäla sitt intresse för att teckna avtal om viss kapacitet innan kapaciteten fördelas, och

2.den kapacitet som inte används görs till föremål för handel på en marknad och att den som har tecknat avtal om kapacitet har möjlighet att bedriva sådan handel.

Den som har ansökt om undantag ska ha fördelat kapaciteten inom sex månader efter det att villkor har fastställts enligt första och andra styckena. Ett undantag får inte beviljas innan kapaciteten har fördelats.

I paragrafen, som är ny, finns bestämmelser om villkor för hanteringen

 

av kapacitet i den nya ledningen eller anläggningen under den tid som

 

undantaget enligt 1 § gäller. Bestämmelserna ska ses mot bakgrund av

 

det som stadgas i artikel 36.6 tredje stycket i gasmarknadsdirektivet. Ett

 

undantag enligt 1 § innebär att en ledning eller en anläggning inte

 

omfattas av bestämmelserna om tredjepartstillträde enligt 3 kap. 5 och

 

6 §§ respektive 4 kap. 5 och 6 §§. Villkoren för kapacitetshantering

 

kommer därför i viss utsträckning att ersätta dessa bestämmelser.

 

Av första stycket framgår att villkoren ska fastställas redan innan det

 

slutliga beslutet i frågan om undantag meddelas. Syftet med detta är att

 

en preliminär fördelning av kapacitet ska äga rum innan frågan om

 

undantag avgörs slutligt.

 

I andra stycket anges vad villkoren ska säkerställa. Det ska vara

 

möjligt för alla potentiella användare av den nya infrastrukturen att

 

anmäla sitt intresse för att teckna avtal om viss kapacitet innan

63

kapaciteten fördelas. Villkoren ska vidare säkerställa att outnyttjad Prop. 2011/12:77 kapacitet bjuds ut på marknaden.

Av tredje stycket framgår att ett undantag inte får beviljas innan kapacitet har fördelats i enlighet med de fastställda villkoren. Potentiella användare måste således ha haft möjlighet att anmäla sitt intresse för att teckna avtal. Resultatet av kapacitetstilldelningen kommer på detta sätt att utgöra en del av beslutsunderlaget.

Övervägandena finns i avsnitt 8.2.2.

4 § Regeringen meddelar föreskrifter om i vilka fall frågor enligt detta kapitel prövas av byrån för samarbete mellan energitillsyns- myndigheter och i vilka fall de prövas av tillsynsmyndigheten.

Paragrafen har fått en ny lydelse. Den innehåller nu en upplysning om att regeringen meddelar föreskrifter om vilket organ som prövar frågor om undantag.

Regeringens föreskrifter kommer att svara mot det som anges i artikel 36 i gasmarknadsdirektivet. Utgångspunkten är att prövningen ska göras av den nationella tillsynsmyndigheten. Av artikel 36.4 framgår dock att det finns två situationer där ACER ska pröva ett ärende om undantag om den berörda infrastrukturen sträcker sig över mer än en medlemsstats territorium. ACER ska utföra de uppgifter som annars tilldelas de berörda medlemsstaternas tillsynsmyndigheter dels om alla de berörda tillsynsmyndigheterna inte har kunnat nå någon överens- kommelse inom sex månader från den dag då begäran om undantag mottogs av den sista av dessa tillsynsmyndigheter, dels på gemensam begäran av de berörda tillsynsmyndigheterna.

Övervägandena finns i avsnitt 8.3.

10 kap.

13 § Regeringen eller den myndighet som regeringen bestämmer får meddela föreskrifter om skyldighet för naturgasleverantörer att dokumentera och bevara uppgifter om leveransavtal, derivatinstrument och transaktioner som gäller sådana avtal eller instrument samt att på begäran lämna sådana uppgifter till en svensk myndighet eller Europeiska kommissionen.

I paragrafen, som är ny, finns ett bemyndigande för regeringen eller den myndighet som regeringen bestämmer att meddela föreskrifter om skyldighet för naturgasleverantörer att bevara information om leverans- avtal och derivatinstrument och att göra informationen tillgänglig dels för svenska nationella myndigheter, dels för Europeiska kommissionen. Bestämmelsen har tillkommit med anledning av artikel 44 i gasmark- nadsdirektivet. Med derivatinstrument avses ett finansiellt instrument vars värde beror på en annan, underliggande tillgång.

Övervägandena finns i avsnitt 9.

64

Ikraftträdande- och övergångsbestämmelser

Prop. 2011/12:77

1.Denna lag träder i kraft den 1 juli 2012.

2.De nya bestämmelserna i 6 kap. 5 § första stycket tillämpas dock inte på

a) sådana tariffer för tillträde till en förgasningsanläggning som gäller för tiden före det räkenskapsår som börjar den 1 januari 2013 eller närmast därefter, eller

b) sådan tariff för tillträde till en förgasningsanläggning som anläggningens innehavare tillämpar från det att en ansökan om godkännande har lämnats in till tillsynsmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om ansökan har lämnats in före utgången av augusti 2012.

Av första punkten framgår att de nya bestämmelserna träder i kraft den 1 juli 2012.

När lagen träder i kraft får innehavaren av en förgasningsanläggning inte tillämpa sin tariff för tillträde till anläggningen förrän de metoder som används för att utforma tariffen har godkänts av tillsynsmyndig- heten. Den bestämmelsen ska enligt andra punkten inte tillämpas på sådana tariffer som gäller för tiden före det räkenskapsår som börjar den 1 januari 2013 eller närmast därefter. Fram till dess får alltså tariffer tillämpas utan tillsynsmyndighetens godkännande.

För att säkerställa att anläggningsinnehavaren kan få frågan om godkännande prövad innan den nya regleringen ska börja tillämpas på det enskilda företagets tariffer föreskrivs vidare de nya bestämmelserna inte ska tillämpas på en sådan tariff för tillträde som anläggningens inne- havare tillämpar från det att en ansökan om godkännande har lämnats in till tillsynsmyndigheten till dess att myndigheten har meddelat beslut i ärendet, om en ansökan lämnas in före utgången av augusti 2012.

Övervägandena finns i avsnitt 5.2. Övergångsbestämmelserna har utformats i linje med Lagrådets förslag.

65

Europaparlamentets och rådets direktiv 2009/72/EG av den 13 juli 2009

14.8.2009

SV

Europeiska unionens officiella tidning

Prop. 2011/12:77

Bilaga 1

L 211/55

DIREKTIV

EUROPAPARLAMENTETS OCH RÅDETS DIREKTIV 2009/72/EG av den 13 juli 2009

om gemensamma regler för den inre marknaden för el och om upphävande av direktiv 2003/54/EG

(Text av betydelse för EES)

EUROPAPARLAMENTET OCH EUROPEISKA UNIONENS RÅD HAR ANTAGIT DETTA DIREKTIV

med beaktande av fördraget om upprättandet av Europeiska gemenskapen, särskilt artiklarna 47.2, 55 och 95,

med beaktande av kommissionens förslag,

med beaktande av yttrandet från Europeiska ekonomiska och sociala kommittén (1),

med beaktande av yttrandet från Regionkommittén (2),

i enlighet med förfarandet i artikel 251 i fördraget (3), och

av följande skäl:

(1)Den inre marknaden för el, som stegvis har genomförts i helagemenskapensedan1999,syftartillattskapafaktiska valmöjligheter för alla kunder i Europeiska unionen, både enskilda och företag, nya affärsmöjligheter och ökad han­ delövergränserna,vilketskaledatillökadeffektivitet,kon­ kurrenskraftiga priser, högre kvalitet på tjänsterna och bidra till försörjningstrygghet och hållbarhet.

(2)Europaparlamentets och rådets direktiv 2003/54/EG av den 26 juni 2003 om gemensamma regler för den inre marknaden för el (4)harihöggradbidragittillattskapaen sådan inre marknad för el.

(3)De friheter som Europeiska unionens medborgare garan­ terasgenomfördraget–blandannat,frirörlighetförvaror, etableringsfrihetenochfrihetenatttillhandahållatjänster–

(1) EUT C 211, 19.8.2008, s. 23. (2) EUT C 172, 5.7.2008, s. 55.

(3) Europaparlamentets yttrande av den 18 juni 2008 (ännu ej offentlig­ gjort i EUT), rådets gemensamma ståndpunkt av den 9 januari 2009 (EUT C 70 E, 24.3.2009, s. 1) och Europaparlamentets ståndpunkt av den 22 april 2009 (ännu ej offentliggjord i EUT). Rådets beslut av den 25 juni 2009.

(4) EUT L 176, 15.7.2003, s. 37.

kan endast uppnås på en fullständigt öppnad marknad, där allakonsumenterfrittkanväljahandlareochdärallahand­ lare kan leverera fritt till sina kunder.

(4)Detföreliggerförnärvarandehindermotattsäljaelpålika villkorochutandiskrimineringellernackdelarigemenska­ pen. Framför allt finns det ännu inte något icke- diskriminerande nättillträde eller någon myndighetstillsyn som är lika effektiv i alla medlemsstater.

(5)En trygg elförsörjning är av avgörande betydelse för sam­ hällsutvecklingen i Europa, för genomförandet av en håll­ bar klimatförändringspolitik samt för främjandet av konkurrenskraftenpådeninremarknaden.Idettasyftebör gränsöverskridande sammanlänkningar utvecklas ytterli­ gare för att trygga försörjningen från alla energikällor till mest konkurrenskraftiga priser för konsumenter och näringsliv inom gemenskapen.

(6)En välfungerande inre elmarknad bör ge producenterna lämpliga incitament att investera i ny elproduktion, också i el från förnybara energikällor, och då särskilt uppmärk­ samma de mest isolerade länderna och regionerna på gemenskapensenergimarknad.Envälfungerandemarknad bör också förse konsumenterna med lämpliga åtgärder för att främja en mer effektiv energianvändning, och trygg energiförsörjning är en förutsättning för detta.

(7)I kommissionens meddelande av den 10januari2007med titeln ”En energipolitik för Europa” framhävdes betydelsen av att fullborda den inre marknaden för el och skapa lika villkor för alla elföretag i gemenskapen. Kommissionens meddelanden av den 10 januari 2007 ”Om utsikterna för den inre el- och gasmarknadenoch Utredning i enlighet med artikel 17 i förordning (EG) nr 1/2003 av de europe­ iska gas- och elsektorerna (slutrapport)visade att nuva­ rande regler och åtgärder inte tillhandahåller den ram som krävs för att målet om en välfungerande inre marknad ska kunna uppnås.

66

Prop. 2011/12:77

Bilaga 1

L 211/56

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

(8)För att trygga konkurrens och elförsörjning till mest kon­ kurrenskraftiga pris bör medlemsstaterna och de nationella tillsynsmyndigheterna underlätta gränsöverskridande till­ träde för nya elhandlare som levererar el från olika energi­ källor samt för nya leverantörer av elproduktion.

(9)Utan effektiv åtskillnad mellan nätverksamhet och verk­ samheter som rör produktion och leverans (”effektiv åtskillnad”) finns det en inneboende risk för diskrimine­ ring, inte bara i samband med nätdriften utan även när det gäller incitamenten för de vertikalt integrerade företagen att göra de investeringar i näten som krävs.

(10)De regler för rättslig och funktionell åtskillnad som anges i direktiv 2003/54/EG har emellertid inte medfört någon effektiv åtskillnad av systemansvariga för överföringssys­ tem. Därför uppmanades kommissionen vid Europeiska rådets möte den 8 – 9 mars2007att utarbeta lagförslag för effektiv åtskillnad mellan leverans och produktion, å ena sidan, och nätverksamhet, å andra sidan.

(11)Effektivåtskillnadkanbarasäkrasgenomattmanundanrö­ jer incitamentet för vertikalt integrerade företag att diskri­ minera konkurrenterna i samband med nättillträde och investeringar. Åtskilt ägande, vilket innebär att nätägaren utses till systemansvarig och att nätägaren är oberoende av leverans- eller produktionsintressen, är helt klart en effektiv och stabil metod för att lösa inbyggda intressekonflikter och säkra försörjningstryggheten. Europaparlamentet hänvisar därför i sin resolution av den 10juli2007om utsikterna för den inre gas- och elmarknaden (1) till åtskilt ägande av över- föringsnäten som det effektivaste verktyget för att främja investeringar i infrastruktur på ett icke-diskriminerande sätt och trygga ett rättvist nättillträde för nya aktörer och trans­ parenspåmarknaden.Vidåtskiltägandebördetdärförstäl­ las krav på medlemsstaterna att säkerställa att en eller flera personer inte kontrollerar ett produktionsföretag eller ett elhandelsföretag samtidigt som den eller de utövar kontroll

över eller rättigheter gentemot en systemansvarig för över­ föringssystemet eller ett överföringssystem. Omvänt bör kontroll över ett överföringssystem eller en systemansvarig för överföringssystemet utesluta möjligheten att utöva kon­ troll över eller rättigheter gentemot ett produktionsföretag eller ett elhandelsföretag. Inom dessa begränsningar bör ett produktionsföretag eller ett elhandelsföretag kunna inneha en minoritetsandel i en systemansvarig för ett överförings­ system eller ett överföringssystem.

(12)Ett system för åtskillnad bör effektivt undanröja eventuella intressekonfliktermellanproducenter,elhandlareochsyste­ mansvariga för överföringssystem för att skapa incitament för nödvändiga investeringar och garantera nya marknads­ aktörers tillträde inom ramen för ett transparent och

effektivt regelverk, samt bör inte skapa ett alltför betung­ ande regelverk för de nationella tillsynsmyndigheterna.

(13)Definitionen av begreppet ”kontroll” är hämtad från rådets förordning (EG) nr 139/2004 av den 20 januari

2004 om kontroll av företagskoncentrationer (EG:s koncentrationsförordning) (2).

(14)Eftersom åtskilt ägande i en del fall innebär att företag måste omstruktureras bör de medlemsstater som beslutar att tillämpa åtskilt ägande beviljas extra tid för att tillämpa de relevanta bestämmelserna. Med tanke på de vertikala kopplingarna mellan el- och gassektorn bör bestämmel­ serna om åtskillnad tillämpas tvärsöver båda sektorerna.

(15)Vid åtskilt ägande bör, för att säkerställa att nätdriften är helt oberoende av leverans- och produktionsintressen och förhindra utbyte av konfidentiella uppgifter, inte samma personsittaistyrelsenförbådeensystemansvarigföröver­ föringssystem eller ett överföringssystem och ett företag som bedriver produktions- eller leveransverksamhet. Av samma skäl bör samma person inte ha rätt att utse med­ lemmar till en styrelse för en systemansvarig för ett över­ föringssystem eller ett överföringssystem och inte heller utöva kontroll över eller rättigheter gentemot ett produk­ tionsföretag eller ett elhandelsföretag.

(16)Inrättandet av systemansvariga eller systemansvariga för överföringssystem vilka är oberoende av leverans- eller produktionsintressen bör göra det möjligt för vertikalt integrerade företag att bibehålla sitt ägande av nättill­ gångar, samtidigt som en effektiv intresseuppdelning säk­ ras, förutsatt att den oberoende systemansvarige (ISO) eller den oberoende systemansvarige för överföring (ITO) utför den systemansvariges samtliga uppgifter samt att detalje­ rad reglering och omfattande myndighetstillsyn införs.

(17)När ett företag som den 3 september 2009 äger ett överfö­ ringssystem ingår i ett vertikalt integrerat företag bör med­ lemsstaterna därför ges ett val mellan ägarskapsåtskild systemansvarig för överföringssystemet (TSO) och infö­ rande av oberoende systemansvariga eller oberoende systemansvariga för överföring utan leverans- eller produktionsintressen.

(18)För att till fullo kunna tillvarata aktieägarnas intressen i vertikalt integrerade företag bör medlemsstaterna kunna välja mellan att antingen införa åtskilt ägande genom direkt avyttring eller genom att dela upp det integrerade företagets aktier på aktier i nätföretaget och aktier i det återstående leverans- och produktionsföretaget, förutsatt att kraven i samband med åtskilt ägande faktiskt har uppfyllts.

(1) EUT C 175 E, 10.7.2008, s. 206.

(2) EUT L 24, 29.1.2004, s. 1.

67

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/57

 

 

 

 

(19)För att införandet av en oberoende systemansvarig eller oberoende systemansvarig för överföring ska vara effektivt bör särskilda kompletterande regler antas. Reglerna för den oberoende systemansvarige för överföring ger ett lämpligt regelverkförattgaranterafungerandekonkurrens,tillräck­ liga investeringar, tillträde för nya aktörer på marknaden och integration av elmarknaderna. Effektiv åtskillnad med hjälp av reglerna för den oberoende systemansvarige för överföring bör bygga på dels en pelare av organisatoriska

åtgärderochåtgärderavseendeförvaltningenavsysteman­ svariga för överföringssystem, dels en pelare av åtgärder avseendeinvesteringar,anslutningavnyproduktionskapa­ citet till nätet och marknadsintegrering genom regionalt samarbete. Oberoendet för den systemansvarige för över­ föring bör också bland annat säkerställas genom vissa ”avkylningsperioder”, under vilka ingen ledningsverksam­ het eller annan relevant verksamhet som ger tillgång till samma information som den som erhållits i en ledande ställning i ett företag utövas inom det vertikalt integrerade företaget. Modellen för effektiv åtskillnad med hjälp av en oberoende systemansvarig för överföring uppfyller de krav som fastställdes vid Europeiska rådets möte den 8 och

9 mars 2007.

(20)I syfte att utveckla konkurrensen på den inre marknaden förelbörstoraicke-hushållskunderharättattväljaelhand­ lare och teckna avtal med flera olika elhandlare för att täcka sitt elförsörjningsbehov. Dessa kunder bör skyddas mot exklusivitetsklausuler som utesluter konkurrerande eller kompletterande anbud.

(21)En medlemsstat har rätt att välja fullständigt åtskilt ägande på sitt territorium. Om en medlemsstat har valt fullstän­ digt åtskilt ägande, har ett företag inte rätt att välja alter­ nativet med en oberoende systemansvarig eller en oberoende systemansvarig för överföring. Företag som bedriver något slags produktions- eller leveransverksamhet får dessutom inte direkt eller indirekt utöva kontroll över ellernågonrättighetgentemotensystemansvarigföröver­ föringssystem från en medlemsstat som har valt fullstän­ digt åtskilt ägande.

(22)Det kommer enligt detta direktiv att finnas olika typer av marknadsorganisation på den inre marknaden för el. De åtgärder som medlemsstaterna kan vidta för att säkerställa lika villkor på marknaden bör grunda sig på överordnade krav av allmänt intresse. Samråd bör ske med kommissio­ nen om åtgärdernas förenlighet med fördraget och gemenskapsrätten.

(23)När en effektiv åtskillnad genomförs, bör principen om icke-diskriminering mellan den offentliga och den privata sektorn respekteras. Därför bör samma person, på egen hand eller tillsammans med någon annan, inte tillåtas att, i

strid med det åtskilda ägandet eller med lösningen med en oberoende systemansvarig, utöva kontroll över eller någon rättighet i fråga om sammansättning av och röstning eller beslutsfattande i både organ för systemansvariga för över­ föringssystem eller överföringssystem och organ för pro­ duktionsföretag eller elhandelsföretag. Under förutsättning att medlemsstaten i fråga kan visa att detta krav uppfylls, bör vid åtskilt ägande och lösningen med en oberoende systemansvarig två skilda offentliga organ kunna kontrol­ lera produktion och leverans å ena sidan och överföring å den andra.

(24)Effektiv åtskillnad mellan å ena sidan nätverksamhet och å andra sidan leverans och produktion bör gälla i hela gemenskapen, för både gemenskapsföretag och icke- gemenskapsföretag. För att säkerställa att å ena sidan nät­ verksamheten och å andra sidan leverans och produktion i gemenskapen bedrivs oberoende av varandra, bör tillsyns­ myndigheterna ges befogenheter att vägra certifiering av sådana systemansvariga för överföringssystem som inte uppfyller bestämmelserna om åtskillnad. För att säkerställa attdessabestämmelsertillämpasenhetligtihelagemenska­ pen bör tillsynsmyndigheterna ta största möjliga hänsyn till kommissionens uppfattning, när de fattar beslut om certifiering. För att dessutom säkerställa att gemenskapens internationella åtaganden respekteras, liksom solidariteten och försörjningstryggheten inom gemenskapen, bör kom­ missionenharättattavgeettyttrandeomcertifieringavse­ ende ägaren till eller den systemansvarige för ett

överföringssystemsomkontrollerasavenellerfleraperso­ ner från tredjeländer.

(25)En tryggad energiförsörjning är absolut nödvändig för den allmänna säkerheten och är därför till sin natur förknippad med en effektivt fungerande inre marknad för el och med en integration av medlemsstaternas separata elmarknader. Elförsörjningen till unionens medborgare kan enbart ske genom ett nät. Fungerande elmarknader, och framför allt de nät och andra tillgångar som är förknippade med elför­ sörjningen, har en avgörande betydelse för den allmänna säkerheten, ekonomins konkurrenskraft och för unions­ medborgarnas välfärd. Personer från tredjeländer bör där­ för endast tillåtas kontrollera ett överföringssystem eller en systemansvarig för överföringssystem, om de uppfyller de krav på effektiv åtskillnad som tillämpas inom gemenska­ pen. Utan att det påverkar gemenskapens internationella

åtaganden anser gemenskapen att sektorn för överförings­ system för el är mycket viktig för gemenskapen och att ytterligare skyddsåtgärder därför behövs när det gäller att upprätthålla en tryggad energiförsörjning till gemenskapen i syfte att förhindra hot mot den allmänna ordningen och den allmänna säkerheten i gemenskapen och unionsmed­ borgarnas välfärd. En trygg energiförsörjning till gemen­ skapen kräver i synnerhet en bedömning av nätdriftens oberoende,nivånpågemenskapensochenskildamedlems­ staters beroende av energiförsörjning från tredjeländer

68

Prop. 2011/12:77

Bilaga 1

L 211/58

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

samt av hur både inhemsk och internationell handel och energiinvesteringarbehandlasiettvissttredjeland.Försörj­ ningstryggheten bör därför bedömas mot bakgrund av de faktiska omständigheterna i varje enskilt fall samt de rät­ tigheter och skyldigheter som uppkommer enligt interna­ tionell rätt, särskilt de internationella avtalen mellan gemenskapen och det berörda tredjelandet. Kommissionen uppmanas att vid behov lägga fram rekommendationer för förhandlingar om relevanta avtal med tredjeländer beträf­ fande trygg energiförsörjning till gemenskapen, eller att ta med de nödvändiga frågorna i andra förhandlingar med dessa tredjeländer.

(26)Icke-diskriminerande tillträde till distributionsnätet är avgörande för tillträdet för kunder i återförsäljarledet.

Utrymmetfördiskrimineringnärdetgällertredjepartstill­ träde och investeringar är dock mindre på distributions­ nivå än på överföringsnivå, eftersom nätbegränsningar och produktions- eller leveransintressenas inflytande i allmän­ hetinteärsåbetydandepådistributionsnivånsompåöver­ föringsnivån. I enlighet med direktiv 2003/54/EG blev rättslig och funktionell åtskillnad av systemansvariga för distributionssystemet dessutom obligatorisk först från och med den 1 juli 2007 och dess effekter på den inre mark­ naden för el har ännu inte utvärderats. De regler om rätts­ lig och funktionell åtskillnad som för närvarande finns kan leda till effektiv åtskillnad förutsatt att de definieras tydli­ gare, genomförs ordentligt och övervakas noggrant. För att skapa lika villkor i återförsäljarledet bör systemansvariga för distributionssystem övervakas, så att de hindras från att dra fördel av sin vertikala integration när det gäller kon­ kurrensläget på marknaden, framför allt gentemot hus­ hållskunder och små icke-hushållskunder.

(27)Medlemsstaterna bör uppmuntra till en modernisering av distributionsnät, exempelvis genom införandet av intelli­ genta nät, som bör vara uppbyggda på ett sätt som uppmuntrar till decentraliserad produktion och energieffektivitet.

(28)Närdetgällersmåsystemkandetvaranödvändigtattstöd­ tjänster tillhandahålls av systemansvariga för överförings­ system som är sammanlänkade med små system.

(29)För att undvika att små systemansvariga för distributions­ systemfårenoproportionerligekonomiskochadministra­ tiv börda bör medlemsstaterna vid behov kunna undanta berörda företag från krav på rättslig åtskillnad när det gäl­ ler distributionen.

(30)När ett slutet distributionssystem används för att skapa optimal effektivitet i en integrerad energiförsörjning som kräver särskilda driftsnormer, eller när ett slutet distribu­ tionssystem upprätthålls i första hand för att användas av systemets ägare, bör det vara möjligt att undanta den sys­ temansvarige för distributionssystemet från skyldigheter som skulle utgöra en onödig administrativ börda på grund

av det särskilda förhållandet mellan den systemansvarige för distributionssystemet och systemets användare. Indu­ striella och kommersiella platser samt platser där gemen­ samma tjänster tillhandahålls, såsom tågstationer, flygplatser, sjukhus, stora campingplatser med integrerade anläggningarellerkemiskaindustrianläggningar,kaninbe­ gripa slutna distributionssystem på grund av att den verk­ samhet som bedrivs i dessa anläggningar är av specialiserad karaktär.

(31)Tillståndsförfarandena får inte leda till en administrativ börda som är oproportionerlig i förhållande till elprodu­ centernas storlek och eventuella inverkan. Obefogat utdragna tillståndsförfaranden kan hindra nya aktörer att komma in på marknaden.

(32)Det behövs ytterligare åtgärder för att säkerställa transpa­ renta och icke-diskriminerande tariffer för tillträde till näten. Tarifferna bör gälla alla användare av systemen, utan diskriminering.

(33)Genom direktiv 2003/54/EG infördes ett krav på med­ lemsstaterna att utse tillsynsmyndigheter med särskilda befogenheter.Erfarenheternavisardockatttillsynenseffek­ tivitetoftahämmasavatttillsynsmyndigheternainteärtill­ räckligt självständiga gentemot staten, har otillräckliga befogenheter och för liten handlingsfrihet. Därför uppma­ nade Europeiska rådet vid sitt möte den 8–9 mars 2007 kommissionen att utarbeta lagstiftningsförslag för ytterli­ gare harmonisering av medlemsstaternas energitillsyns­ myndigheters befogenheter och förstärkning av deras oberoende. Det bör vara möjligt för dessa nationella till­ synsmyndigheter att omfatta både el- och gassektorn.

(34)För att den inre marknaden för el ska kunna fungera kor­ rekt behöver energitillsynsmyndigheterna kunna fatta beslut i alla relevanta tillsynsfrågor, och de måste också vara fullständigt oberoende av övriga offentliga eller pri­ vata intressen. Detta hindrar inte domstolsprövning och parlamentarisk övervakning enligt medlemsstaternas kon­ stitutionella rätt. Vidare får inte den nationella lagstiftarens godkännande av tillsynsmyndigheters budget utgöra ett hinder för budgetmässig självständighet. Reglerna om till­ synsmyndighetens självständiga ansvar för genomförandet av den anslagna budgeten bör tillämpas inom ramen för nationell budgetlagstiftning och nationella budgetbestäm­ melser. Samtidigt som medlemsstaterna med hjälp av ett lämpligtroterandesystembidrartilldennationellatillsyns­ myndighetens oberoende gentemot politiska eller ekono­ miska intressen, bör medlemsstaterna ha möjlighet att vederbörligen beakta de tillgängliga personella resurserna och styrelsens storlek.

(35)För att säkerställa effektivt marknadstillträde för alla marknadsaktörer, inklusive nya aktörer, krävs icke- diskriminerande balansmekanismer som avspeglar

69

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/59

 

 

 

 

kostnaderna. När likviditetsnivån på elmarknaden väl är tillräckligt hög, bör detta uppnås genom att man inför sådana transparenta marknadsbaserade mekanismer för försörjning och inköp av el som krävs för att uppfylla kra­ ven på balans. Så länge likviditetsnivån på marknaden inte är tillräckligt hög, bör de nationella tillsynsmyndigheterna arbeta aktivt för att balanstarifferna ska vara icke- diskriminerande och avspegla kostnaderna. Samtidigt bör lämpliga incitament tillhandahållas för att balansera pro­ duktionochförbrukningavelochförattinteäventyrasys­ temet. Systemansvariga för överföringssystem bör göra det lättareförslutförbrukareochsammanslutningaravslutför­ brukare att medverka på reserv- och balansmarknader.

(36)De nationella tillsynsmyndigheterna bör kunna fastställa eller godkänna tariffer eller beräkningsmetoder för tariffer på grundval av ett förslag från den systemansvarige för överförings- eller distributionssystemet eller på grundval av ettförslagsomensystemansvarigochnätanvändarna kom­ mit överens om. Vid fastställandet eller godkännandet bör de nationella tillsynsmyndigheterna se till att överförings- eller distributionstarifferna är icke-diskriminerande och avspeglar kostnaderna och samtidigt ta hänsyn till de lång­ siktiga marginalkostnader för näten som går att undvika med hjälp av distribuerad produktion och åtgärder för styr­ ning av efterfrågan.

(37)Energitillsynsmyndigheterna bör ha befogenhet att fatta bindande beslut avseende elföretag och antingen själva besluta, eller föreslå att en behörig domstol beslutar, om effektiva, proportionerliga och avskräckande sanktioner för elföretag som inte fullgör sina skyldigheter. Energitill­ synsmyndigheterna bör även ges befogenhet att, oavsett tillämpningen av konkurrensbestämmelserna, fatta beslut om lämpliga åtgärder som säkerställer fördelar för kun­ derna genom främjande av den effektiva konkurrens som är nödvändig för att den inre marknaden för el ska fungera korrekt. Införandet av virtuella elkraftanläggningar – dvs. program för frigörande av el varigenom elföretag är skyl­ diga att sälja eller ställa en viss elvolym till förfogande eller medge åtkomst till en del av sin produktionskapacitet för intresserade elhandelsföretag under en viss tidsperiod – är en av möjliga åtgärder för att främja effektiv konkurrens och säkerställa att marknaden fungerar korrekt. Energitill­ synsmyndigheterna bör även ges befogenheter att bidra till att säkerställa en hög standard på samhällsomfattande och allmännyttiga tjänster som står i samklang med kraven på öppnande av marknaden, skydd för utsatta kunder och ett verkligt effektivt konsumentskydd. Dessa bestämmelser bör varken påverka kommissionens befogenheter att til­ lämpa konkurrensreglerna, inbegripet granskningen av företagskoncentration med en gemenskapsdimension, eller reglerna för den inre marknaden, såsom den fria rörlighe­ ten för kapital. Det oberoende organ till vilket en part som

berörs av ett beslut av en nationell tillsynsmyndighet har rätt att överklaga kan vara en domstol eller annan rättslig instans med befogenhet att genomföra en rättslig prövning.

(38)Harmonisering av de nationella tillsynsmyndigheternas befogenheter bör inbegripa befogenheter att erbjuda elfö­ retagen incitament och befogenheter att fastställa effektiva, proportionerliga och avskräckande sanktioner för dessa företag eller att föreslå en behörig domstol att besluta om sådana sanktioner. Dessutom bör tillsynsmyndigheterna ha befogenhet att begära in relevant information från elföre­ tagen, göra lämpliga och tillräckliga undersökningar samt lösa tvister.

(39)Den inre marknaden för el har vissa brister när det gäller likviditet och transparens, vilket hindrar effektiv resursför­ delning, riskhantering och etablering av nya företag på marknaden. Det finns ett behov av ökad konkurrens och försörjningstrygghet genom att anslutning av nya kraftverk till elnätet underlättas i samtliga medlemsstater, särskilt genom att nya marknadsaktörer uppmuntras. Förtroendet för marknaden, dess likviditet och antalet marknadsaktö­ rerbehöveröka,ochdärförmåstetillsynenavföretagverk­ samma på området för elförsörjning stärkas. Sådana krav bör inte påverka, och bör vara förenliga med, befintlig gemenskapslagstiftning beträffande finansmarknaderna.

Tillsynsmyndigheterna för energisektorn och för finans­ marknaden behöver samarbeta för att göra det möjligt för varandra att få en överblick över berörda marknader.

(40)Innankommissionenantarriktlinjerförkravennärdetgäl­ ler bevarande av information, bör byrån för samarbete mellanenergitillsynsmyndigheter,inrättadgenomEuropa­ parlamentets och rådets förordning (EG) nr 713/2009 av den 13 juli 2009 om inrättande av en byrå för samarbete mellan energitillsynsmyndigheter (1), nedan kallad byrån, och Europeiska värdepapperstillsynskommittén (EVTK), inrättad genom kommissionens beslut 2009/77/EG (2), samråda och råda kommissionen om innehållet i dessa riktlinjer. Byrån och EVTK bör också samarbeta för att ytterligare utreda och ge råd i frågan om huruvida trans­ aktioner med avtal om leverans av el och elderivat bör omfattas av transparenskrav före eller efter handel och i så fall hur dessa krav bör utformas.

(41)Medlemsstaterna eller, om en medlemsstat föreskrivit detta, tillsynsmyndigheten bör uppmuntra utvecklingen av avbrytbara leveransavtal.

(42)Av rättvise- och konkurrensskäl samt indirekt för att skapa arbetstillfällen bör industrin och handeln i hela gemenska­

pen, inbegripet små och medelstora företag, och alla

(1) Se sidan 1 i detta nummer av EUT. (2) EUT L 25, 29.1.2009, s. 18.

70

Prop. 2011/12:77

Bilaga 1

L 211/60

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

unionsmedborgare som åtnjuter de ekonomiska fördelarna meddeninremarknadenocksåkunnaåtnjutaenhögkon­ sumentskyddsnivå, särskilt hushållskunder, och, när med­ lemsstater anser det lämpligt, bör småföretag också kunna komma i åtnjutande av garantier för tillhandahållande av allmännyttiga tjänster, särskilt med avseende på försörj­ ningstrygghet och skäliga tariffer. Dessa kunder bör också ha rätt till valmöjligheter, rättvisa, representation och mekanismer för tvistlösning.

(43)Nästan alla medlemsstater har valt att säkerställa konkur­ rensen på elproduktionsmarknaden genom ett transparent tillståndsförfarande. Om tillräcklig elproduktionskapacitet inte anläggs på grundval av tillståndsförfarandet, bör dock medlemsstaterna se till att det finns en möjlighet att bidra till att trygga försörjningen genom ett anbudsförfarande eller ett liknande förfarande. Medlemsstaterna bör ha möj­ lighetatt,förattskyddamiljönochgynnanyatekniskalös­ ningar, se till att det finns möjlighet att upphandla ny kapacitet genom ett anbudsförfarande grundat på offent­ liggjorda kriterier. Sådan ny kapacitet omfattar bland annat el från förnybara energikällor och kraftvärmeproduktion.

(44)Av försörjningstrygghetsskäl bör balansen mellan tillgång och efterfrågan på el i varje enskild medlemsstat bevakas, varefter en rapport bör utarbetas om situationen i gemen­ skapen som helhet med hänsyn till sammanlänkningska­ paciteten mellan områden. Denna övervakning bör göras i tillräckligt god tid, så att lämpliga åtgärder hinner vidtas om försörjningstryggheten äventyras. Det faktum att nöd­ vändig nätinfrastruktur, bland annat sammanlänkningska­ paciteten, anläggs och underhålls bör bidra till en stabil elförsörjning. Underhåll och anläggning av nödvändig nätinfrastruktur, inbegripet sammanlänkningskapaciteten och decentraliserad elproduktion, är viktiga förutsättningar för att garantera en stabil elförsörjning.

(45)Medlemsstaterna bör tillförsäkra hushållskunder och, när medlemsstaterna anser det lämpligt, små företag rätten att få tillgång till el av en bestämd kvalitet till priser som kan jämföras enkelt och klart samt är transparenta och rimliga.

För att säkerställa att de allmännyttiga tjänsterna i gemen­ skapen håller hög kvalitet bör medlemsstaterna regelbun­ det underrätta kommissionen om alla åtgärder som vidtagits för att uppnå målet med detta direktiv. Kommis­ sionenbörregelbundetoffentliggöraenrapportsominne­ håller en analys av de nationella åtgärder som vidtagits för att uppnå målsättningarna när det gäller allmännyttiga tjänster samt en jämförelse av åtgärdernas effektivitet, i syfte att utfärda rekommendationer om vilka nationella åtgärder som bör vidtas för att de allmännyttiga tjänsterna ska hålla hög kvalitet. Medlemsstaterna bör vidta de åtgär­ der som är nödvändiga för att skydda utsatta kunder på deninremarknadenförel.Sådanaåtgärderkanvarieraallt­ efter de särskilda omständigheterna i medlemsstaterna i

fråga och kan inbegripa specifika åtgärder avseende betal­ ningavelräkningarellermergenerellaåtgärderinomsoci­ alförsäkringssystemet. När samhällsomfattande tjänster även tillhandahålls små företag, kan åtgärderna för att säkerställa att dessa samhällsomfattande tjänster tillhanda­ hålls vara olika för hushållskunder och små företag.

(46)Respekt för kraven när det gäller allmännyttiga tjänster är ett grundläggande krav i detta direktiv, och det är viktigt att det i direktivet anges gemensamma minimikrav som upp­ fylls av samtliga medlemsstater och som beaktar målen om konsumentskydd, försörjningstrygghet, miljöskydd samt likvärdiga konkurrensnivåer i samtliga medlemsstater. Det är viktigt att kraven när det gäller allmännyttiga tjänster kan tolkas på nationell grund, med beaktande av natio­ nella omständigheter, om inte annat följer av gemenskapslagstiftningen.

(47)Medlemsstaternabörhamöjlighetattutseensistahandsel­ handlare. Denne elhandlare kan vara försäljningsavdel­ ningen i ett vertikalt integrerat företag som även fungerar somdistributör,underförutsättningattdettauppfyllerkra­ ven på åtskillnad i detta direktiv.

(48)De åtgärder som medlemsstaterna vidtar för att uppnå målen när det gäller social och ekonomisk sammanhåll­ ning bör bland annat kunna innefatta lämpliga ekono­ miska stimulansåtgärder, där så är lämpligt med hjälp av alla tillgängliga nationella verktyg och gemenskapsverktyg. Dessa verktyg kan innefatta ansvarsmekanismer för att säkerställa nödvändiga investeringar.

(49)Om de åtgärder som medlemsstaterna vidtar för att full­ göra skyldigheten att tillhandahålla allmännyttiga tjänster kan definieras som statligt stöd enligt artikel 87.1 i fördra­ get är medlemsstaterna enligt artikel 88.3 i fördraget skyl­ diga att underrätta kommissionen om detta.

(50)Kravennärdetgällerallmännyttigatjänster,inklusivesam­ hällsomfattandetjänster,ochdegemensammaminiminor­ mer som är en följd av dem måste stärkas ytterligare för att alla konsumenter, särskilt utsatta konsumenter, ska kunna gynnas av konkurrensen och skäliga priser. Kraven på all­ männyttiga tjänster bör definieras på nationell nivå och med hänsyn till nationella omständigheter; gemenskaps­ lagstiftningen bör emellertid respekteras av medlemssta­ terna. Unionsmedborgarna och, när medlemsstaterna finner det lämpligt, småföretagen bör garanteras allmän­ nyttiga tjänster, i synnerhet försörjningstrygghet ochrim­ liga tariffer. En viktig aspekt när det gäller leverans till

71

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/61

 

 

 

 

konsumenterna är tillgången till objektiva och transparenta förbrukningsuppgifter. Konsumenterna bör således ha till­ gång till sina förbrukningsuppgifter och tillhörande priser och servicekostnader så att de kan begära in offerter från konkurrenter på grundval av dessa uppgifter. Konsumen­ terna bör även ha rätt att få ordentlig information om sin energianvändning. Förskottsbetalningarna bör återspegla den sannolika elförbrukningen och de olika betalningssys­ temen bör vara icke-diskriminerande. Om konsumenterna tillräckligt ofta ges information om energikostnaderna kommer de att uppmuntras till att spara energi, eftersom konsumenterna direkt ser effekterna av investeringar i energieffektivitet och ändrat beteende. Ett fullständigt genomförande av Europaparlamentets och rådets direktiv 2006/32/EG av den 5 april 2006 om effektiv slutanvänd­ ning av energi och om energitjänster (1) kommer i detta hänseende att kunna hjälpa konsumenterna att reducera sina energikostnader.

(51)Konsumenternas intresse bör ståicentrum fördettadirek­ tiv och tjänsternas kvalitet bör höra till elföretagens cen­ trala ansvarsområden. Befintliga konsumenträttigheter behöver stärkas och tryggas och bör innefatta ökad trans­ parens. Konsumentskyddet bör säkerställa att alla konsu­ menter inom gemenskapens utökade ansvarsområde kan dra nytta av en konkurrensutsatt marknad. Medlemssta­ terna eller, om en medlemsstat föreskrivit detta, tillsyns­ myndigheterna, bör se till att konsumenträttigheterna tillgodoses.

(52)Konsumenterna bör få tydlig och begriplig information om sinarättigheteriförhållandetillenergisektorn.Kommissio­ nen bör, efter samråd med berörda intressenter, bland dem medlemsstaterna, de nationella tillsynsmyndigheterna, konsumentorganisationerochelföretag,fastställaenlättill­ gänglig och användarvänlig kontrollista för energianvän­ dare, där konsumenterna får praktiska upplysningar om sina rättigheter. Alla konsumenter bör få denna kontrol­ lista och den bör göras tillgänglig för allmänheten.

(53)Energifattigdom är ett växande problem i gemenskapen. De medlemsstater som berörs bör därför, om de ännu inte gjort det, utarbeta nationella handlingsplaner eller andra lämpliga ramar för att åtgärda energifattigdomen, varvid syftet bör vara att minska antalet personer som lever i energifattigdom. Under alla omständigheter bör medlems­ staternasäkranödvändigenergiförsörjningförutsattakun­ der. En integrerad metod skulle kunna användas, till exempel inom socialpolitiken, och åtgärderna skulle kunna

(1) EUT L 114, 27.4.2006, s. 64.

vara socialpolitiska eller inrikta sig på bättre energieffekti­ vitet i bostäder. Detta direktiv bör åtminstone medge en nationell politik till förmån för utsatta kunder.

(54)Effektiva möjligheter till tvistlösning för alla konsumenter borgar för ett bättre konsumentskydd. Medlemsstaterna bör införa snabba och effektiva förfaranden för behandling av klagomål.

(55)Det bör vara möjligt att basera införandet av system med smarta mätare på en ekonomisk bedömning. Om det vid en sådan bedömning skulle framgå att det endast är eko­ nomiskt rimligt och kostnadseffektivt med sådana mätare för konsumenter med en viss elförbrukning bör medlems­ staterna ha möjlighet att ta hänsyn till detta när de bygger ut systemen med smarta mätare.

(56)Marknadspriserna bör ge de rätta incitamenten för utveck­ lingen av nätet och investeringar i ny elproduktion.

(57)Det bör vara av största vikt för medlemsstaterna att verka för fungerande konkurrens och att olika elhandlare utan svårighet får tillträde till marknaden samt att främja ny elproduktionskapacitet för att konsumenterna verkligen ska kunna dra full fördel av en liberaliserad inre marknad för el.

(58)Medlemsstaterna bör inför inrättandet av en inre marknad för el främja integrationen av sina inhemska marknader och samarbetet mellan systemoperatörer på gemenskaps­ nivå och regional nivå, vilket också bör omfatta de isole­ rade system som bildar så kallade elöar, som fortfarande existerar i gemenskapen.

(59)Ett viktigt mål för detta direktiv bör vara att med hjälp av ett sammanlänkat nät över hela gemenskapen utveckla en verklig europeisk inre marknad för el, och tillsynsmyndig­ heterna bör därför ha som en av sina huvuduppgifter att, i förekommandefallinärasamarbetemedbyrån,skötareg­ leringen av gränsöverskridande sammanlänkningar och regionala marknader.

(60)Ett annat viktigt mål för detta direktiv bör vara att garan­ tera gemensamma bestämmelser för en verklig inre mark­ nad för el och ett brett elutbud som är tillgängligt för alla. Korrekta marknadspriser skulle i detta syfte ge incitament till gränsöverskridande sammanlänkningar och investe­ ringar i ny elproduktion, samtidigt som de på lång sikt skulle leda till priskonvergens.

(61)Tillsynsmyndigheterna bör också tillhandhålla information om marknaden så att kommissionen kan utöva sin roll som observatör och övervakare av den inre marknaden för el och dess utveckling på kort, medellång och lång sikt,

72

Prop. 2011/12:77

Bilaga 1

L 211/62

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

inklusive aspekter som produktionskapacitet, olika källor förelproduktion,infrastrukturföröverföringochdistribu­ tion, tjänsternas kvalitet, gränsöverskridande handel, han­ tering av överbelastning, investeringar, grossist- och konsumentpriser, marknadens likviditet samt miljö- och effektivitetsförbättringar. Nationella tillsynsmyndigheter börunderrättakonkurrensmyndigheternaochkommissio­ nen om de medlemsstater där priserna utgör ett hinder för konkurrensen och en väl fungerande marknad.

(62)Eftersommåletfördettadirektiv,nämligenattskapaenfull­ ständigt fungerande inre marknad för el, inte i tillräcklig utsträckning kan uppnås av medlemsstaterna och det där­ för bättre kan uppnås på gemenskapsnivå, kan gemenska­ pen vidta åtgärder i enlighet med subsidiaritetsprincipen i artikel 5 i fördraget. I enlighet med proportionalitetsprinci­ pen i samma artikel går detta direktiv inte utöver vad som är nödvändigt för att uppnå detta mål.

(63)Enligt Europaparlamentets och rådets förordning (EG) nr 714/2009 av den 13 juli 2009 om villkor för tillträde till nät för gränsöverskridande elhandel (1) kan kommissio- nen anta riktlinjer i syfte att uppnå den harmoniserings­ grad som krävs. Sådana riktlinjer, som utgör bindande genomförandeåtgärder, är, även med avseende på vissa bestämmelser i detta direktiv, ett användbart hjälpmedel som snabbt kan ändras om det skulle behövas.

(64)De åtgärder som är nödvändiga för att genomföra detta direktiv bör antas i enlighet med rådets beslut

1999/468/EGavden28juni1999om de förfaranden som skall tillämpas vid utövandet av kommissionens genomförandebefogenheter (2).

(65)Kommissionen bör särskilt ges befogenhet att anta de rikt­ linjer som krävs för att den grad av harmonisering ska kunna åstadkommas som behövs för att syftet med detta direktiv ska kunna uppnås. Eftersom dessa åtgärder har en allmän räckvidd och avser att ändra icke väsentliga delar av detta direktiv genom att komplettera det med nya icke väsentligadelar,måstedeantasienlighetmeddetföreskri­ vande förfarandet med kontroll i artikel 5a i beslut 1999/468/EG.

(66)Ienlighetmedpunkt34idetinterinstitutionellaavtaletom bättre lagstiftning (3) uppmuntras medlemsstaterna att för egen del och i gemenskapens intresse upprätta egna tabel­ lersomsåvittdetärmöjligtvisaröverensstämmelsenmel­ lan detta direktiv och införlivandeåtgärderna samt att offentliggöra dessa tabeller.

(1) Se sidan 15 i detta nummer av EUT. (2) EGT L 184, 17.7.1999, s. 23.

(3) EUT C 321, 31.12.2003, s. 1.

(67)Med tanke på omfattningen av ändringarna av direktiv

2003/54/EG är det av tydlighets- och rationaliseringsskäl

önskvärt att det görs en omarbetning av bestämmelserna i fråga till en enda text i ett nytt direktiv.

(68)Detta direktiv står i överensstämmelse med de grundläg­ gande rättigheter och principer som erkänns särskilt i Europeiska unionens stadga om de grundläggande rättigheterna.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

KAPITEL I

SYFTE, TILLÄMPNINGSOMRÅDE OCH DEFINITIONER

Artikel 1

Syfte och tillämpningsområde

Idettadirektivfastställsgemensammareglerförproduktion,över­ föring, distribution och leverans av el, samt bestämmelser om konsumentskydd, i syfte att förbättra och integrera konkurrens­ utsatta elmarknader i gemenskapen. Det innehåller regler för elsektorns organisation och funktion, öppet tillträde till markna­ den, kriterier och förfaranden som ska tillämpas för anbud, för beviljande av tillstånd och för driften av system. Det fastställer även krav på samhällsomfattande tjänster och elkonsumenters rättigheter och klargör konkurrenskraven.

Artikel 2

Definitioner

I detta direktiv avses med

1.produktion: framställning av el.

2.producent: en fysisk eller juridisk person som framställer el.

3.överföring: transport av el i sammanlänkade system med hög­ spänningsnät samt nät med extra hög spänning för tillhan­ dahållande till slutförbrukare eller distributörer, men inte leverans.

4.systemansvarig för överföringssystemet: varje fysisk eller juridisk person som ansvarar för drift och underhåll och, vid behov, utbyggnad av överföringssystemet inom ett visst område och, i tillämpliga fall, dess sammanlänkningar till andra system och för att säkerställa att systemet på lång sikt kan uppfylla rimliga krav på överföring av el.

5.distribution: transport av el i system med högspännings-, mellanspännings- och lågspänningsnät för tillhandahållande till kunder, men inte leverans.

73

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/63

 

 

 

 

6.systemansvarig för distributionssystemet: varje fysisk eller juridisk person som ansvarar för drift och underhåll och, vid behov, utbyggnad av distributionssystemet inom ett visst område och, i tillämpliga fall, dess sammanlänkningar till andra sys­ tem och för att säkerställa att systemet på lång sikt kan upp­ fylla rimliga krav på distribution av el.

7.kund: grossist eller slutförbrukare av el.

8.grossist: varje fysisk eller juridisk person som köper el i syfte att återförsälja den inom eller utanför det system i vilket per­ sonen är etablerad.

9.slutförbrukare: kund som köper el för eget bruk.

10.hushållskund:kundsomköperelförsinegenhushållsförbruk­ ning och inte för kommersiell verksamhet eller yrkesverksamhet.

11.icke-hushållskund: varje fysisk eller juridisk person, inklusive producenter och grossister, som köper el som inte är avsedd för egen hushållsförbrukning.

12.berättigad kund: kund som fritt kan välja elhandlare i den mening som avses i artikel 33.

13.sammanlänkning: utrustning som används för sammanlänk­ ning av elsystem.

14.sammanlänkat system:ettantal överförings- ochdistributions­ system som kopplas samman med hjälp av en eller flera sammanlänkningar.

15.direktledning: antingen en elledning som kopplar samman en enskild produktionsplats medenenskild kund,ellerenelled­ ning som kopplar samman en elproducent och en elhandlare så att dessa direkt kan försörja sina egna fastigheter, dotter­ bolag och berättigade kunder.

16.ekonomisk rangordning: rangordning av källor som tillhanda­ håller elleveranser enligt ekonomiska kriterier.

17.stödtjänst: varje tjänst som behövs för driften av ett överförings- eller distributionssystem.

18.systemanvändare: varje fysisk eller juridisk person som levere­ rar till eller får leveranser från ett överförings- eller distributionssystem.

19.leverans eller handel: försäljning, inbegripet återförsäljning, av el till kunder.

20.integrerat elföretag: ett vertikalt eller horisontellt integrerat företag.

21.vertikalt integrerat företag: ett elföretag eller en grupp av elfö­ retag där samma person(er) direkt eller indirekt har rätt att utöva kontroll och där det berörda företaget eller den berörda företagsgruppen bedriver verksamhet inom minst ett av områdenaöverföringellerdistributionochminstettavområ­ dena produktion eller leverans av el.

22.anknutet företag: ett anknutet företag enligt betydelsen i arti­ kel 41 i rådets sjunde direktiv 83/349/EEG av den 13 juni 1983 grundat på artikel 44.2 g (*) i fördraget om samman- ställd redovisning (1),och/ellerettintresseföretagenligtbety- delsen i artikel 33.1 i samma direktiv och/eller ett företag som tillhör samma aktieägare.

23.horisontellt integrerat företag:ettföretagsombedriververksam­ het inom minst ett av områdena produktion för försäljning, överföring, distribution eller leverans av el samt en annan verksamhet utan anknytning till el.

24.anbudsförfarande: förfarande genom vilket planerade ytterli­ gare behov och ersättningskapacitet täcks genom leveranser från ny eller befintlig produktionskapacitet.

25.långtidsplanering: planering av investeringsbehovet i fråga om produktions-, överförings- och distributionskapacitet på lång sikt för att kunna tillmötesgå efterfrågan på el i systemet och för att säkra leveranserna till kunderna.

26.litet enskilt system: varje system med en förbrukning på min­ dre än 3 000 GWh under 1996, där mindre än 5 % av års­ förbrukningen erhålls genom sammanlänkning med andra system.

27.enskilt mikrosystem: varje system med en förbrukning på min­ dre än 500 GWh under 1996 och där det inte finns någon koppling till andra system.

28.tillförlitlighet: både leverans- och försörjningstrygghet i fråga om el och teknisk säkerhet.

29.styrning av energieffektivitet/energiefterfrågan: en övergripande eller integrerad metod som syftar till att påverka elförbruk­ ningens omfattning och den tidpunkt vid vilken elen förbru­ kas för att därigenom minska förbrukningen av primärenergi och toppbelastningar genom att i stället för investeringar i

ökadproduktionskapacitetgynnainvesteringarienergieffek­ tivitetsåtgärder eller andra åtgärder, såsom leveransavtal som kan avbrytas, om det sistnämnda alternativet är mest effek­ tivt och ekonomiskt med hänsyn till de positiva effekterna för miljön och försörjningstrygghets- och distributionskost­ nadsaspekterna av lägre energiförbrukning.

(*) Titeln till direktiv 83/349/EEG har justerats med hänsyn till omnum­ reringen av artiklarna i fördraget om upprättandet av Europeiska gemenskapen, i enlighet med artikel 12 i Amsterdamfördraget. Ursprungligen hänvisades till artikel 54.3 g.

(1) EGT L 193, 18.7.1983, s. 1.

74

Prop. 2011/12:77

Bilaga 1

L 211/64

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

30.förnybara energikällor: förnybara icke-fossila energikällor (vindkraft, solenergi, jordvärme, våg- och tidvattenenergi, vattenkraft,biomassa,deponigas,gasfrånavloppsreningsan­ läggningar och biogaser).

31.distribuerad produktion: produktionsanläggningar som är anslutna till distributionssystem.

32.avtal om leverans av el: ett avtal om leverans av el, men som inte inbegriper ett elderivat.

33.elderivat: ett finansiellt instrument som anges i en av punk­ terna 5, 6 eller 7 i avsnitt C i bilaga I till Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument (1) och som avser el.

34.kontroll: rättigheter, avtal eller andra medel som, antingen var för sig eller tillsammans och med hänsyn till alla faktiska eller rättsliga förhållanden, ger möjlighet att utöva ett avgörande inflytande på ett företag, särskilt genom

2.Medlemsstaterna får med beaktande fullt ut av tillämpliga bestämmelser i fördraget, särskilt artikel 86 i detta, för att tillgo­ dosedetallmännaekonomiskaintressetåläggaföretagsombedri­ ver verksamhet inom elsektorn att tillhandahålla allmännyttiga tjänster,vilkakanavsetillförlitlighet,inbegripetförsörjningstrygg­ het, regelbundenhet i leveranserna, kvalitet och pris samt miljö­ skydd, inbegripet energieffektivitet, energi från förnybara energikällor och klimatskydd. Dessa åligganden ska vara klart definierade, transparenta, icke-diskriminerande och kontroller­ bara samt garantera att elföretag i gemenskapen kan nå ut till nationellakonsumenterpålikavillkor.Närdetgällerförsörjnings­ trygghet, styrning av energieffektivitet/energiefterfrågan och för att uppfylla de miljömål och mål för energi från förnybara ener­ gikällorsomavsesidennapunktfårmedlemsstaternainföralång­ tidsplanering, varvid hänsyn ska tas till att tredje part kan komma att ansöka om tillträde till systemet.

3.Medlemsstaternaskainomsittterritoriumsetillattallahus­ hållskunder, och, när medlemsstaterna anser det lämpligt, små företag (det vill säga företag som har färre än 50 anställda och en

årlig omsättning eller balansomslutning som inte överstiger

10miljonerEUR),harrätttillsamhällsomfattandetjänster,detvill säga rätt till elleveranser av en bestämd kvalitet till rimliga, lätt och tydligt jämförbara, transparenta och icke-diskriminerande priser. För att säkerställa leveranser av samhällsomfattande tjäns­ ter får medlemsstaterna utse en sistahandselhandlare. Medlems­

a)äganderättellernyttjanderätttillettföretagssamtligatill­ staterna ska ålägga distributionsföretagen att ansluta kunderna till

gångar eller en del av dessa,

b)rättigheter eller avtal som ger ett avgörande inflytande på sammansättningen av ett företags organ och dessas voteringar eller beslut.

35.elföretag: varje fysisk eller juridisk person, med undantag för slutförbrukare,sombedriveråtminstoneenavföljandeverk­ samheter: produktion, överföring, distribution, leverans eller inköp av el och som ansvarar för kommersiella och tekniska arbetsuppgifter eller underhåll i samband med dessa verksamheter.

KAPITEL II

ALLMÄNNA REGLER FÖR ORGANISATIONEN AV SEKTORN

Artikel 3

Skyldighet att tillhandahålla allmännyttiga tjänster och skyddet av kunderna

1. Medlemsstaterna ska, utan att det påverkar tillämpningen av punkt 2, på grundval av sin institutionella organisation och med vederbörlig hänsyn till subsidiaritetsprincipen, se till att elföretag drivs i enlighet med principerna i detta direktiv för att uppnå en konkurrensutsatt, säker och miljömässigt hållbar elmarknad, och de får inte göra någon diskriminerande åtskillnad mellan dessa företag när det gäller deras rättigheter eller skyldigheter.

(1) EUT L 145, 30.4.2004, s. 1.

sina nät enligt villkor och tariffer som fastställts i enlighet med förfarandet i artikel 37.6. Inget i detta direktiv får hindra med­ lemsstaterna från att stärka hushållskundernas och de små och medelstora förbrukarnas ställning på marknaden genom att främja möjligheterna till frivillig samgång mellan företrädare för dessa konsumentkategorier.

Första stycket ska genomföras på ett transparent och icke- diskriminerande sätt och ska inte hindra öppnandet av markna­ derna enligt vad som föreskrivs i artikel 33.

4.Medlemsstaterna ska se till att alla kunder har rätt att få sin elförsörjning tillhandahållen av en elhandlare, under förutsättning att denne samtycker, oberoende av vilken medlemsstat elhandla­ ren är registrerad i, så länge elhandlaren följer gällande regler för handel och balans. Med avseende på detta ska medlemsstaterna vidta alla åtgärder som är nödvändiga för att se till att adminis­ trativa förfaranden inte diskriminerar leveransföretag som redan är registrerade i en annan medlemsstat.

5.Medlemsstaterna ska säkerställa

a)att om en kund under iakttagande av de avtalsenliga villko­ ren önskar byta elhandlare, den eller de berörda operatörerna genomför detta byte inom tre veckor, och

b)att kunderna har rätt att erhålla samtliga relevanta förbrukningsuppgifter.

Medlemsstaterna ska se till att alla kunder garanteras de rättighe­ ter som avses i leden a och b på ett icke-diskriminerande sätt i fråga om kostnader, arbete eller tidsåtgång.

75

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/65

 

 

 

 

6.Om det tillhandahålls ekonomisk ersättning, annan form av ersättning och exklusiva rättigheter som en medlemsstat beviljar föruppfyllandetavåliggandenaipunkterna2och3,skadettaske på ett icke-diskriminerande och transparent sätt.

7.Medlemsstaterna ska vidta lämpliga åtgärder för att skydda slutförbrukare, och de ska särskilt se till att utsatta kunder får till­ räckligt skydd. Varje medlemsstat ska härvidlag definiera begrep­ pet utsatta kunder, varvid det kan hänvisas till energifattigdom och bland annat föreskrivas förbud mot avstängning av dessa kunder från elleverans i kritiska situationer. Medlemsstaterna ska se till att rättigheter och skyldigheter för utsatta kunder respekte­ ras.Deskaframföralltvidtalämpligaåtgärderförattskyddaslut­ förbrukare i avlägsna områden. De ska säkerställa en hög konsumentskyddsnivå, särskilt vad gäller transparens i fråga om allmänna avtalsvillkor, allmän information och mekanismer för tvistlösning. Medlemsstaterna ska se till att berättigade kunder i praktiken lätt kan byta till en ny elhandlare. Åtminstone när det gäller hushållskunder ska dessa åtgärder omfatta dem som anges i bilaga I.

8.Medlemsstaterna ska vidta lämpliga åtgärder, såsom att utfärda nationella energihandlingsplaner, föreskriva om förmåner inom socialförsäkringssystemen för att utsatta kunder ska få den elförsörjning de behöver, eller stödja energieffektivitetsförbätt­ ringar för att åtgärda energifattigdom där sådan fastställts, också i samband med åtgärder mot fattigdom överlag. Sådana åtgärder ska inte hindra ett effektivt öppnande av marknaderna enligt vad som föreskrivs i artikel 33 eller en välfungerande marknad, och kommissionen ska i förekommande fall underrättas i enlighet med bestämmelserna i punkt 15 i denna artikel. Sådan underrät­ telsefårävenomfattaåtgärdersomvidtasinomramenfördetall­ männa socialförsäkringssystemet.

9.Medlemsstaterna ska se till att elhandlarna på eller i sam­ band med fakturorna och i reklam som riktar sig till slutförbru­ kare anger följande:

a)Varjeenskildenergikällasandelavdengenomsnittligabräns­ lesammansättning som företaget använt under det gångna

året, på ett sätt som är begripligt och, på nationell nivå, tyd­ ligt jämförbart.

b)Åtminstone hänvisning till befintliga referenskällor, t.ex. webbsidor, där information finns tillgänglig för allmänheten om den inverkan på miljön som elframställningen från den sammanlagda bränslesammansättning som elhandlaren använtunderdetföregåendeårethar,åtminstonenärdetgäl­ ler utsläpp av CO2 och radioaktivt avfall.

Tillsynsmyndigheten eller annan behörig nationell myndighet ska vidta nödvändiga åtgärder för att se till att den information som elhandlare tillhandahåller sina kunder i enlighet med denna arti­ kel är tillförlitlig och att den, på nationell nivå, tillhandahålls på ett tydligt och jämförbart sätt.

10.Medlemsstaterna ska vidta åtgärder för att uppnå målen för social och ekonomisk sammanhållning samt miljöskydd, vil­ ket vid behov ska inkludera åtgärder för styrning av energieffektivitet/energiefterfrågan och metoder för att bekämpa klimatförändringar samt försörjningstrygghet. Dessa åtgärder kan särskilt omfatta lämpliga ekonomiska stimulansåtgärder, där så är lämpligt med hjälp av alla tillgängliga nationella verktyg och gemenskapsverktyg, för underhåll och anläggning av nödvändig nätinfrastruktur, inbegripet sammanlänkningskapacitet.

11.För att främja energieffektiviteten ska medlemsstaterna eller, om en medlemsstat föreskrivit detta, tillsynsmyndigheten starkt rekommendera att elföretagen optimerar elförbrukningen, till exempel genom att tillhandahålla energiförvaltning, utveckla innovativa former för prissättning eller införa system med smarta mätare eller intelligenta nät, om det är lämpligt.

12.Medlemsstaterna ska se till att det inrättas gemensamma kontaktpunkter där konsumenterna kan få tillgång till all nödvändig information om sina rättigheter, gällande lagstiftning och möjligheter till tvistlösning i händelse av en tvist. Dessa kontaktpunkter kan vara en del av allmänna konsumentupplysningsställen.

13.Medlemsstaterna ska se till att det finns en oberoende mekanism, till exempel i form av en energiombudsman eller ett konsumentorgan, för att säkerställa effektiv behandling av klago­ mål och tvistlösning utanför domstol.

14.Medlemsstaterna får besluta att inte tillämpa bestämmel­ sernaiartiklarna7,8,32och/eller34,idenutsträckning somtil­ lämpningen av dessa, rättsligt eller i praktiken, skulle hindra elföretagen från att fullgöra de förpliktelser som ålagts dem i det allmänna ekonomiska intresset och i den mån som handelns utveckling inte påverkas i en sådan utsträckning att det skulle strida mot gemenskapens intressen. Gemenskapens intressen omfattar bland annat konkurrens när det gäller berättigade kun­ der i enlighet med detta direktiv och artikel 86 i fördraget.

c)Informationomderasrättigheterochmöjlighetertilltvistlös­ ning i händelse av en tvist.

Vad gäller leden a och b i första stycket, för el som anskaffats på en elbörs eller importerats från ett företag som är beläget utanför gemenskapen, får aggregerade uppgifter som börsen eller företa­ get tillhandahållit under föregående år användas.

15. Medlemsstaternaskanärdegenomförtdettadirektivinfor­ mera kommissionen om vilka åtgärder som vidtagits för att full­ göra förpliktelserna att tillhandahålla samhällsomfattande och allmännyttiga tjänster, inklusive konsument- och miljöskyddsåt­ gärder, och om åtgärdernas eventuella inverkan på nationell och internationell konkurrens, oavsett om åtgärderna kräver undan­ tag från detta direktiv eller ej. De ska därefter vartannat år under­ rätta kommissionen om eventuella ändringar av dessa åtgärder, oavsett om de kräver undantag från detta direktiv eller ej.

76

Prop. 2011/12:77

Bilaga 1

L 211/66

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

16. Kommissionen ska, efter samråd med berörda intressen­ ter, däribland medlemsstaterna, de nationella tillsynsmyndighe­ terna, konsumentorganisationer och elföretag, samt, utifrån de framsteg som hittills gjorts, med arbetsmarknadens parter, fast­ ställa en klar och kortfattad kontrollista för energianvändare, med praktiska upplysningar om energianvändarnas rättigheter. Med­ lemsstaterna ska se till att elhandlarna eller de systemansvariga för distributionssystemet i samarbete med tillsynsmyndigheten vid­ tar nödvändiga åtgärder för att alla deras konsumenter ska få ett exemplar av kontrollistan för energianvändare och se till att den finns tillgänglig för allmänheten.

Artikel 4

Övervakning av försörjningstryggheten

Medlemsstaterna ska se till att frågor som rör försörjningstrygg­ het övervakas. Vid behov får medlemsstaterna överlåta denna uppgift till de tillsynsmyndigheter som avses i artikel 35. Denna

övervakning ska i synnerhet omfatta balansen mellan tillgång och efterfråganpådeninhemskamarknaden,förväntadframtidaefter­ frågan, ytterligare kapacitet som planeras eller håller på att anläg­ gas, samt nätens kvalitet och underhållsnivå samt åtgärder för att täcka efterfrågetoppar och hantera brister i leverans från en eller flera elhandlares sida. De behöriga myndigheterna ska senast den 31 juli vartannat år offentliggöra en rapport i vilken resultaten av

övervakningen av dessa frågor och de åtgärder som vidtagits eller planerats ska anges; rapporten ska därefter genast överlämnas till kommissionen.

Artikel 5

Tekniska regler

Tillsynsmyndigheterna, om medlemsstaterna föreskrivit detta, eller medlemsstaterna ska se till att tekniska säkerhetskriterier definieras och att det utarbetas och offentliggörs tekniska regler, i vilka delägsta tekniska konstruktions- ochdriftkraven föranslut­ ning till systemet av produktionsanläggningar, distributionssys­ tem, direktanslutna konsumenters utrustning, sammanlänkningar försammankopplingochdirektledningarfastställs.Dessatekniska regler ska säkerställa att systemen är driftskompatibla, och de ska vara objektiva och icke-diskriminerande. Byrån får vid behov utfärda lämpliga rekommendationer för att dessa regler ska bli förenliga med varandra. Dessa regler ska anmälas till kommissio­ nen i enlighet med artikel 8 i Europaparlamentets och rådets direktiv 98/34/EG av den 22 juni 1998 om ett informationsför­ farande beträffande tekniska standarder och föreskrifter och beträffande föreskrifter för informationssamhällets tjänster (1).

Artikel 6

Främjande av regionalt samarbete

medlemsstaterna främja och underlätta regionalt samarbete mel­ lan de systemansvariga för överföringssystemen, bland annat i gränsöverskridande frågor, för att skapa en konkurrensutsatt inre marknad för el, verka för att lagar, föreskrifter och tekniska ramar

är konsekventa och underlätta integrationen av de isolerade sys­ temsombildarsåkalladeelöar,somfortfarandeexisterarigemen­ skapen. Det geografiska område som omfattas av detta regionala samarbete ska omfatta samarbete inom geografiska områden i enlighet med artikel 12.3 i förordning (EG) nr 714/2009. Detta samarbete får omfatta andra geografiska områden.

2.Byrån ska samarbeta med de nationella tillsynsmyndighe­ terna och de systemansvariga för överföringssystemen för att de olika regionernas regelverk ska vara förenliga med målet att skapa en konkurrensutsatt inre marknad för el. Om byrån anser att det krävs bindande regler för ett sådant samarbete ska den utfärda lämpliga rekommendationer.

3.Medlemsstaterna ska vid genomförandet av detta direktiv se till att de systemansvariga för överföringssystemen har ett eller flera regionalt integrerade system som omfattar två eller flera medlemsstater för kapacitetstilldelning och för kontroll av säker­ heten för nätet.

4.Om vertikalt integrerade systemansvariga för överförings­ systemen deltar i ett samriskföretag som inrättats i syfte att genomförasamarbetet,skasamriskföretagetupprättaochgenom­ föraenövervakningsplanmedåtgärdersomskavidtasförattför­ hindra diskriminerande och konkurrensbegränsande beteende. I övervakningsplanen ska det anges vilka specifika skyldigheter de anställda har för att uppfylla målet att utesluta diskriminering och beteenden som motverkar konkurrens. Planen ska underställas byråns godkännande. De övervakningsansvariga för de vertikalt integrerade systemansvariga för överföringssystemen ska obero­ ende av andra kontrollera att planen följs.

KAPITEL III

PRODUKTION

Artikel 7

Tillståndsförfarande för ny kapacitet

1. Vidanläggningavnyproduktionskapacitetskamedlemssta­ terna använda ett tillståndsförfarande som ska genomföras enligt objektiva, transparenta och icke-diskriminerande kriterier.

1. Medlemsstaterna liksom tillsynsmyndigheterna ska samar­ beta med varandra i syfte att integrera sina inhemska marknader på en eller flera regionala nivåer, som ett första steg mot skapan­ det av en helt liberaliserad inre marknad. I synnerhet ska tillsyns­ myndigheterna, om medlemsstaterna föreskrivit detta, eller

(1) EGT L 204, 21.7.1998, s. 37.

2. Medlemsstaterna ska fastställa kriterier för beviljandet av tillstånd att anlägga produktionskapacitet på deras territorium. Vid fastställandet av lämpliga kriterier ska medlemsstaterna ta hänsyn till

a)säkerhet och tillförlitlighet i elsystemet, elinstallationer och tillhörande utrustning,

77

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/67

 

 

 

 

b)skydd av folkhälsa och allmän säkerhet,

c)miljöskydd,

d)markanvändning och lokalisering,

e)användningen av allmän mark,

att erbjuda ny kapacitet eller åtgärder för styrning av energieffektiviteten/energiefterfrågan. Dessa förfaranden får dock baraanvändasomdenproduktionskapacitetsomanläggsmedtil­ lämpning av tillståndsförfarandet eller de åtgärder som vidtas för styrning av energieffektivitet/energiefterfrågan inte är tillräckliga för att säkerställa försörjningstryggheten.

f)energieffektivitet,

g)typ av primärkällor,

h)sökandens specifika egenskaper, t.ex. teknisk, ekonomisk och finansiell förmåga,

i)överensstämmelse med de åtgärder som vidtagits i enlighet med artikel 3,

j)produktionskapacitetens bidrag till uppnåendet av gemen­ skapensövergripandemålomattåtminstone20 %avgemen­ skapens slutliga energianvändning (brutto) år 2020 ska kommafrånförnybaraenergikällor,ienlighetmedartikel3.1 i Europaparlamentets och rådets direktiv 2009/28/EG av den 23april2009om främjande av användningen av energi från förnybara energikällor (1), och

k)produktionskapacitetens bidrag till utsläppsminskning.

3. Medlemsstaterna ska se till att det finns särskilda tillstånds­ förfaranden för liten decentraliserad produktion och/eller distri­ buerad produktion, som tar hänsyn till deras begränsade storlek och eventuella inverkan.

Medlemsstaterna får fastställa riktlinjer för detta särskilda till­ ståndsförfarande. De nationella tillsynsmyndigheterna eller andra behöriga nationella myndigheter, även planeringsmyndigheter, ska se över dessa riktlinjer och får rekommendera ändringar.

Ommedlemsstaternaharfastställtsärskildaförfarandenförbevil­ jande av markanvändning för stora nya infrastrukturprojekt som avser produktionskapacitet, ska medlemsstaterna vid behov se till att dessa förfaranden omfattar anläggandet av ny produktionska­ pacitet och att de tillämpas på ett icke-diskriminerande sätt och inom en lämplig tidsram.

4. Förfarandena och kriterierna för beviljande av tillstånd ska offentliggöras. Om en ansökan om tillstånd avslås ska den sökande informeras om skälen för avslagsbeslutet. Dessa skäl ska vara objektiva, icke-diskriminerande, välgrundade och vederbör­ ligen motiverade. Den sökande ska ha möjlighet att överklaga.

Artikel 8

Anbudsförfarande för ny kapacitet

1. För att trygga försörjningen ska medlemsstaterna se till att det genom ett anbudsförfarande eller ett annat förfarande som är likvärdigt i fråga om transparens och icke-diskri­ minering, grundat på offentliggjorda kriterier, finns möjlighet

(1) EUT L 140, 5.6.2009, s. 16.

2.Medlemsstaterna får för att skydda miljön och gynna nya tekniska lösningar se till att det finns möjlighet att upphandla ny kapacitet genom ett anbudsförfarande grundat på offentliggjorda kriterier. Ett sådant anbudsförfarande får gälla ny kapacitet eller åtgärder för styrning av energieffektiviteten/energiefterfrågan. Ett anbudsförfarande får dock bara användas om den produktions­ kapacitet som anläggs med tillämpning av tillståndsförfarandet eller de åtgärder som vidtas inte är tillräckliga för att uppnå dessa mål.

3.Närmare uppgifter om ett anbudsförfarande avseende pro­ duktionskapacitet och åtgärder för styrning av energieffek- tivitet/energiefterfrågan ska offentliggöras i Europeiska unionens officiella tidning senastsexmånaderföredensistadagenförinläm­ nande av anbud.

Anbudsspecifikationerna ska göras tillgängliga i tillräckligt god tid för att alla intresserade företag som är etablerade på en medlems­ stats territorium ska kunna lämna in anbud.

I syfte att säkerställa transparens och icke-diskriminering ska anbudsspecifikationerna innehålla en detaljerad beskrivning av kontraktsspecifikationerna och det förfarande som ska följas av alla anbudsgivare samt en uttömmande förteckning över de kri­ terier som ska styra urvalet av anbudsgivare och tilldelningen av kontrakt,inklusivestimulansåtgärdersomomfattasavanbudsför­ farandet, t.ex. subventioner. Dessa specifikationer får också avse de områden som anges i artikel 7.2.

4.Ianbudsinfordringaravseendeerforderligproduktionskapa­ citet ska hänsyn också tas till anbud om elleveranser med lång­ tidsgarantier från befintliga produktionsanläggningar, under förutsättning att tilläggskrav kan tillgodoses på detta sätt.

5.Medlemsstaterna ska utse en myndighet, ett offentligt organ eller ett enskilt organ vars verksamhet inte omfattar elproduktion, elöverföring, eldistribution eller elleveranser och som kan vara en tillsynsmyndighetenligtartikel35.1,attansvaraförorganisation, övervakningochkontrollavanbudsförfarandetipunkterna1–4i den här artikeln. Om den systemansvarige för överföringssyste­ met är helt oberoende av annan verksamhet utan ägarsamband med överföringssystemet, får den systemansvarige utses till det organ som ansvarar för organisation, övervakning och kontroll av anbudsförfarandet. Denna myndighet eller detta organ ska vidta allanödvändigaåtgärderförattsäkerställaattuppgifternaianbu­ den behandlas konfidentiellt.

78

Prop. 2011/12:77

Bilaga 1

L 211/68

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

KAPITEL IV

DRIFT AV ÖVERFÖRINGSSYSTEM

Artikel 9

Åtskillnad av överföringssystem och systemansvariga för överföringssystem (TSO)

1. Medlemsstaterna ska se till att följande gäller från och med den 3 mars 2012.

a)Varje företag som äger ett överföringssystem ska agera som systemansvarig för överföringssystemet.

b)Samma person(er) får inte

i)direkt eller indirekt utöva kontroll över ett företag som bedriver produktions- eller leveransverksamhet och direkt eller indirekt utöva kontroll över eller någon rät­ tighet gentemot en systemansvarig för överföringssys­ tem eller ett överföringssystem, eller

ii)direkt eller indirekt utöva kontroll över en systemansva­ rig för överföringssystem eller över ett överföringssys­ tem och direkt eller indirekt utöva kontroll över eller någon rättighet gentemot ett företag som bedriver produktions- eller leveransverksamhet.

c)Samma person(er) får inte, för en systemansvarig för överfö­ ringssystemellerförettöverföringssystem,utseledamötertill styrelsen, tillsynsorganet eller organ som juridiskt företräder företaget, och direkt eller indirekt utöva kontroll över eller någon rättighet gentemot ett företag som bedriver produktions- eller leveransverksamhet.

d)Samma person får inte vara ledamot i styrelsen, tillsynsorga­ net eller organ som juridiskt företräder företaget för både ett företag som bedriver produktions- eller leveransverksamhet och för en systemansvarig för överföringssystem eller ett överföringssystem.

2. De rättigheter som avses i punkt 1 b och c ska i synnerhet omfatta

a)rätten att rösta,

b)befogenheten att utse ledamöter till styrelsen, tillsynsorganet eller organ som juridiskt företräder företaget, eller

c)rätten att inneha ägarmajoriteten.

3. I punkt 1bska begreppet ”företag som bedriver produktions- eller leveransverksamhet, omfatta det som avses med detta begrepp i Europaparlamentets och rådets direktiv 2009/73/EGavden13juli2009om gemensamma regler för den

inre marknaden för naturgas (1)ochtermerna”systemansvarigför överföringssystem” och ”överföringssystem” omfatta ”systeman­ svarig för överföringssystem” och ”överföringssystem” i den mening som avses i det direktivet.

4.Medlemsstaterna får bevilja undantag från punkt 1 b och c till och med den 3 mars 2013, under förutsättning att den syste­ mansvarige för överföringssystemet inte ingår i ett vertikalt inte­ grerat företag.

5.Den skyldighet som avses i punkt 1 a ska anses vara full­ gjord då två eller flera företag som äger överföringssystem har upprättat ett samriskföretag som för de berörda överföringssys­ temen fungerar som systemansvarig för överföringssystem i två eller flera medlemsstater. Inget annat företag får ingå i samriskfö­ retagetsåvidadetintehargodkäntssomoberoendesystemansva­ rig i enlighet med artikel 13 eller som en oberoende systemansvarig för överföring i enlighet med kapitel V.

6.Vidtillämpningenavdennaartikelska,omdenpersonsom avses i punkt 1 b, c och d är medlemsstaten eller ett annat offent­ ligtorgan,tvåseparataoffentligaorgansomutövarkontrollöver, å ena sidan, en systemansvarig för överföringssystemet eller över ett överföringssystem och, å andra sidan, över ett företag som bedriver antingen produktions- eller leveransverksamhet, inte anses vara samma person eller samma personer.

7.Medlemsstaterna ska se till att varken sådana kommersiellt känsliga uppgifter som avses i artikel 16, och som innehas av en systemansvarig för överföringssystemet som har ingått i ett ver­ tikalt integrerat företag, eller personal hos en sådan systemansva­ rig för överföringssystemet överförs till företag som bedriver produktions- eller leveransverksamhet.

8.Om överföringssystemet den 3 september 2009 tillhör ett vertikalt integrerat företag, får en medlemsstat besluta att inte til­ lämpa punkt 1.

I sådant fall ska den berörda medlemsstaten antingen

a)utse en oberoende systemansvarig i enlighet med artikel 13, eller

b)följa bestämmelserna i kapitel V.

9.Om överföringssystemet den 3 september 2009 tillhör ett vertikaltintegreratföretag,ochdetfinnsarrangemangsomsäker­ ställer ett mer effektivt oberoende för den systemansvarige än bestämmelserna i kapitel V, får medlemsstaterna besluta att inte tillämpa punkt 1.

10.Innan ett företag godkänns och utses till systemansvarig för överföringssystem enligt punkt 9 i denna artikel, ska det cer­ tifierasienlighetmeddeförfarandensomföreskrivsiartikel10.4, 10.5 och 10.6 i detta direktiv och i artikel 3 i förordning (EG) nr 714/2009 enligt vilken kommissionen ska kontrollera att befintliga arrangemang klart säkerställer ett mer effektivt obero­ endefördensystemansvarigeföröverföringssystemetänbestäm­ melserna i kapitel V.

(1) Se sidan 94 i detta nummer av EUT.

79

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/69

 

 

 

 

11.Vertikalt integrerade företag som äger ett överföringssys­ tem får inte i något fall hindras från att vidta åtgärder för att upp­ fylla villkoren i punkt 1.

12.Företag som bedriver någon av funktionerna produktions- eller leveransverksamhet får inte under några omständigheter kunna direkt eller indirekt ta kontroll över eller utöva någon rät­ tighet gentemot ägarmässigt åtskilda systemansvariga för överfö­ ringssystem i medlemsstater som tillämpar punkt 1.

Artikel 10

Utseende och certifiering av systemansvariga för överföringssystem (TSO)

1.Innan ett företag godkänns och utses till systemansvarig för

överföringssystem ska det certifieras enligt förfarandena i punk­ terna4,5och6idenhärartikelnochiartikel3iförordning(EG) nr 714/2009.

2.Ett företag som äger ett överföringssystem och som av den nationella tillsynsmyndigheten, till följd av nedanstående certifie­ ringsförfarande, intygas uppfylla kraven i artikel 9, ska av med­ lemsstaterna godkännas och utses till systemansvarig för

överföringssystemet. Utnämningen av systemansvariga för över­ föringssystemet ska anmälas till kommissionen och offentliggö­ ras i Europeiska unionens officiella tidning.

3.Systemansvariga för överföringssystemet ska till tillsyns­ myndigheten anmäla planerade transaktioner som kan komma att kräva en omprövning av huruvida de uppfyller kraven i artikel 9.

4.Tillsynsmyndigheterna ska kontrollera att de systemansva­ riga för överföringssystemet fortlöpande uppfyller kraven i arti­ kel 9. För att säkerställa att kraven uppfylls ska de i följande fall inleda ett certifieringsförfarande:

a)Efter anmälan från den systemansvarige för överföringssys­ temet i enlighet med punkt 3.

b)På eget initiativ då de får vetskap om att en planerad föränd­ ring när det gäller rättigheter gentemot eller inflytande över ägare av eller systemansvariga för överföringssystemet kan ledatillöverträdelseavartikel 9,ellerdådeharanledning att misstänka att en sådan överträdelse kan ha skett.

c)Efter en motiverad begäran från kommissionen.

5. Tillsynsmyndigheterna ska fatta beslut om certifiering av en systemansvarig för överföringssystemet inom fyra månader från den dag då denne inkom med anmälan eller kommissionen över­ lämnade sin begäran. När denna period har löpt ut ska certifie­ ringen anses vara beviljad. Tillsynsmyndighetens uttryckliga eller underförstådda beslut ska börja gälla först efter det att det förfa­ rande som avses i punkt 6 har fullföljts.

6.Tillsynsmyndigheten ska utan dröjsmål anmäla det uttryck­ liga eller underförstådda beslutet om certifiering av en systeman­ svarig för överföringssystemet till kommissionen, och förse kommissionen med alla relevanta uppgifter avseende detta beslut.

Kommissionen ska agera i enlighet med förfarandet i artikel 3 i förordning (EG) nr 714/2009.

7.Tillsynsmyndigheterna och kommissionen får begära sådan informationfrånsystemansvarigaföröverföringssystemochföre­ tag som bedriver produktions- eller leveransverksamhet som är relevant för fullgörandet av deras skyldigheter enligt denna artikel.

8.Tillsynsmyndigheterna och kommissionen ska behandla kommersiellt känsliga uppgifter konfidentiellt.

Artikel 11

Certifiering i förhållande till tredjeländer

1. Om certifiering begärs av ägaren till eller den systemansva­ rige för ett överföringssystem som kontrolleras av en eller flera personer från tredjeländer, ska tillsynsmyndigheten underrätta kommissionen.

Tillsynsmyndigheten ska även utan dröjsmål underrätta kommis­ sionen om eventuella omständigheter som skulle leda till att en eller flera personer från tredjeländer får kontroll över ett överfö­ ringssystem eller en systemansvarig för överföringssystem.

2.Den systemansvariga för överföringssystemet ska underrätta tillsynsmyndigheten om eventuella omständigheter som skulle leda till att en eller flera personer från tredjeländer får kon­ troll över överföringssystemet eller den systemansvarige för överföringssystemet.

3.Tillsynsmyndigheten ska anta ett utkast till beslut om certi­ fiering av en systemansvarig för överföringssystemet inom fyra månaderefteranmälanfråndensystemansvarigeföröverförings­ systemet. Tillsynsmyndigheten ska vägra certifiering om det inte visats

a)att den berörda enheten uppfyller kraven i artikel 9, och

b)för tillsynsmyndigheten eller annan behörig myndighet som utsettsavmedlemsstaten,attettbeviljandeavcertifieringinte kommer att äventyra en trygg energiförsörjning i medlems­ staten och gemenskapen. När denna fråga beaktas ska till­ synsmyndigheten eller annan behörig utsedd myndighet ta hänsyn till

i)gemenskapens rättigheter och skyldigheter med avseende på dessa tredjeländer enligt internationell rätt, inbegripet avtal med ett eller flera tredjeländer som gemenskapen är part i och som rör trygg energiförsörjning,

80

Prop. 2011/12:77

Bilaga 1

L 211/70

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

ii)medlemsstatens rättigheter och skyldigheter med avse­ ende på dessa tredjeländer, enligt avtal som ingåtts med tredjeländerna i den mån avtalen överensstämmer med gemenskapslagstiftningen, och

iii)andra specifika omständigheter och förhållanden i fallet och i det berörda tredjelandet.

4.Tillsynsmyndigheten ska utan dröjsmål anmäla beslutet till kommissionen, tillsammans med all relevant information beträf­ fande beslutet.

5.Medlemsstaterna ska se till att tillsynsmyndigheten eller den utseddabehörigamyndighetsomavsesipunkt3b,innantillsyns­ myndigheten antar ett beslut om certifiering, begär ett yttrande från kommissionen om huruvida

a)den berörda enheten uppfyller kraven i artikel 9, och

b)ett beviljande av certifiering kan äventyra en trygg energiför­ sörjning till gemenskapen.

6. Kommissionen ska behandla den begäran som avses i punkt 5 så snart den har mottagits. Inom två månader efter det attbegäranharmottagitsskakommissionenavgesittyttrandetill dennationellatillsynsmyndigheteneller,ombegärankommitfrån den utsedda behöriga myndigheten, till den myndigheten.

När kommissionen utarbetar sitt yttrande kan den begära in syn­ punkter från byrån, berörd medlemsstat och berörda parter. Om kommissionen framställer en sådan begäran ska tvåmånaderspe­ rioden förlängas med två månader.

Om kommissionen inte har avgett något yttrande inom den period som avses i första och andra styckena ska den inte anses ha några invändningar mot tillsynsmyndighetens beslut.

7. När kommissionen bedömer huruvida den kontroll som utövas av en eller flera personer från tredjeländer kommer att

äventyratryggenergiförsörjningtillgemenskapen,skadenbeakta

a)de särskilda omständigheterna i fallet och i det eller de berörda tredjeländerna, och

b)gemenskapens rättigheter och skyldigheter med avseende på det eller de tredjeländerna enligt internationell rätt, inbegri­ pet avtal med ett eller flera tredjeländer som gemenskapen är part i och som rör trygg energiförsörjning.

8. Den nationella tillsynsmyndigheten ska anta sitt slutliga beslut om certifieringen inom två månader efter utgången av den period som avses i punkt 6. När den nationella tillsynsmyndighe­ tenantarsittslutligabeslutskadentastörstahänsyntillkommis­ sionens yttrande. I varje fall ska medlemsstaterna ha rättatt vägra

certifiering när beviljande av certifiering äventyrar en trygg ener­ giförsörjningidenegnamedlemsstatenellerienannanmedlems­ stat. När en medlemsstat har utsett en annan behörig myndighet förattbedömapunkt3b,kanmedlemsstatenkrävaattdennatio­ nella tillsynsmyndigheten antar sitt slutliga beslut i överensstäm­ melse med den behöriga myndighetens bedömning. Den nationella tillsynsmyndighetens slutliga beslut och kommissio­ nens yttrande ska offentliggöras tillsammans. Om det slutliga beslutet avviker från kommissionens yttrande ska den berörda medlemsstaten tillhandahålla och offentliggöra, tillsammans med beslutet, skälen för detta beslut.

9.Inget i denna artikel ska påverka medlemsstaternas rätt att, i överensstämmelse med gemenskapsrätten, utöva inhemsk rätts­ lig kontroll för att skydda legitima intressen som rör allmän säkerhet.

10.Kommissionen får anta riktlinjer för det förfarande som ska följas vid tillämpningen av denna artikel. Dessa åtgärder, som avser att ändra icke väsentliga delar av detta direktiv genom att komplettera det, ska antas i enlighet med det föreskrivande förfa­ rande med kontroll som avses i artikel 46.2.

11.Denna artikel, med undantag av punkt 3 a, ska också til­ lämpas på medlemsstater som omfattas av ett undantag enligt artikel 44.

Artikel 12

Uppgifter som åligger de systemansvariga för överföringssystemet (TSO)

Varje systemansvarig för överföringssystemet ska ansvara för följande:

a)Attsäkerställasystemetslångsiktigaförmågaattuppfyllarim­ liga krav på överföring av el, att på affärsmässiga villkor och med vederbörlig hänsyn till miljön driva, underhålla och utveckla säkra, tillförlitliga och effektiva överföringssystem.

b)Attsäkerställatillräckligaresurserförfullgörandetavskyldig­ heten att tillhandahålla tjänster.

c)Att bidra till försörjningstryggheten genom lämplig överfö­ ringskapacitet och systemtillförlitlighet.

d)Att styra elkraftflödena i systemet, med beaktande av utby­ ten med andra sammanlänkade system. Den systemansvarige ska för detta ändamål ansvara för att kraftsystemet är säkert, tillförlitligt och effektivt och därvid säkerställa att alla nöd­ vändiga stödtjänster, även sådana som styrs av efterfrågan, är tillgängliga idenmånsomdenna tillgänglighet äroberoende av andra överföringssystem med vilket systemet är sammanlänkat.

e)Att förse den systemansvarige för andra system med vilka systemet är sammanlänkat med tillräcklig information för att säkerocheffektivdrift,samordnadutvecklingochdriftskom­ patibilitet i det sammanlänkade systemet ska kunna säkerställas.

81

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/71

 

 

 

 

f)Attsäkerställaattingen diskriminerande åtskillnad görs mel­ lan systemanvändare eller kategorier av systemanvändare, i synnerhet inte till förmån för anknutna företag.

g)Att förse systemanvändarna med den information som behövs för att de ska kunna få effektivt tillträde till systemet.

h)Att inkassera kapacitetsavgifter och betalningar inom ramen för kompensationsmekanismen mellan systemansvariga för

överföringsnäten i enlighet med artikel 13 i förordning (EG) nr714/2009,attbeviljaochadministreratredjepartstillträde och ge motiverade förklaringar då sådant tillträde nekas, vil­ ket ska övervakas av de nationella tillsynsmyndigheterna, varviddesystemansvarigaföröverföringssystemet,dådefull­ gör sina uppgifter enligt denna artikel, främst ska underlätta marknadsintegrationen.

Artikel 13

Oberoende systemansvariga (ISO)

1.Om överföringssystemet tillhör ett vertikalt integrerat före­ tag den 3september2009fårmedlemsstaternabeslutaattintetil­ lämpa artikel 9.1 och utse en oberoende systemansvarig (ISO) på förslag av överföringssystemets ägare (TSOW). En sådan utnäm­ ning ska godkännas av kommissionen.

2.Medlemsstaten får endast godkänna och utse en oberoende systemansvarig om följande villkor är uppfyllda:

a)Den sökande har visat att den uppfyller kraven i artikel 9.1 b, c och d.

b)Densökandeharvisatattdenförfogarövernödvändigaeko­ nomiska, tekniska, fysiska och mänskliga resurser för att utföra sina uppgifter enligt artikel 12.

c)Den sökande förbinder sig att genomföra en tioårig nätut­ vecklingsplan som övervakas av tillsynsmyndigheten.

d)Överföringssystemets ägare har uppvisat förmåga att fullgöra sina skyldigheter enligt punkt 5. För detta ändamål ska äga­ ren tillhandahålla samtliga utkast till avtal med det sökande företaget och övriga relevanta enheter.

e)Den sökande har visat förmåga att fullgöra sina skyldigheter enligt förordning (EG) nr 714/2009, inbegripet samarbete mellan systemansvariga för överföringssystem på europeisk och regional nivå.

3.Företagsomavtillsynsmyndighetenintygasuppfyllavillko­ ren i artikel 11 och punkt 2 i den här artikeln ska av medlems­ staterna godkännas och utnämnas till oberoende systemansvariga.

Certifieringsförfarandet i antingen artikel 10 i detta direktiv och artikel 3 i förordning (EG) nr 714/2009 eller artikel 11 i detta direktiv ska tillämpas.

4.Varje oberoende systemansvarig ska ansvara för att bevilja och förvalta tredje parts tillträde, inbegripet inkasseringen av avgifter för tillträde, kapacitetsavgifter och betalningar inom ramen för kompensationsmekanismen mellan systemansvariga för överföringsnäten i enlighet med artikel 13 i förordning (EG) nr714/2009samtattdriva,underhållaochutvecklaöverförings­ systemet och att säkerställa att systemet på lång sikt kan uppfylla rimliga krav genom investeringsplanering. Vid utvecklingen av överföringssystemet ska den oberoende systemansvarige ansvara för planering (inbegripet tillståndsförfarande), uppförande och idriftsättningavdennyainfrastrukturen.Idettasyfteskadenobe­ roende systemansvarige agera som systemansvarig för överfö­ ringssystemet i enlighet med detta kapitel. Överföringssystemets

ägare ska inte ansvara för att bevilja och förvalta tredje parts till­ träde eller för investeringsplanering.

5.Om en oberoende systemansvarig har utsetts ska överfö­ ringssystemets ägare fullgöra följande skyldigheter:

a)Tillhandahålladenoberoendesystemansvarigedetsamarbete och stöd som krävs för att denne ska kunna utföra sina upp­ gifter, i synnerhet all relevant information.

b)Finansieradeinvesteringarsomdenoberoendesystemansva­ rige har beslutat om och som godkänts av tillsynsmyndighe­ ten, eller medge att finansieringen görs av någon berörd part, inklusive den oberoende systemansvarige. Finansieringsme­ toden ska godkännas av tillsynsmyndigheten. Tillsynsmyn­ digheten ska, innan beslut om godkännande fattas, samråda med överföringssystemets ägare och de andra berörda parterna.

c)Stå för skadeståndsansvar i anslutning till nättillgångarna, med undantag av den del av ansvaret som avser den obero­ ende systemansvariges uppgifter.

d)Gegarantierförattunderlättafinansieringenavutbyggnadav nätet, med undantag av sådana investeringar där ägaren, i enlighet med b, har medgivit att finansieringen görs av någon berörd part, inklusive den oberoende systemansvarige.

6. Den berörda nationella konkurrensmyndigheten ska i nära samverkan med tillsynsmyndigheten ges alla relevanta befogen­ heter för att på ett effektivt sätt kunna övervaka att ägaren av

överföringssystemet fullgör sina skyldigheter enligt punkt 5.

Artikel 14

Åtskillnad av ägare till överföringssystem (TSOW)

1. Om en oberoende systemansvarig har utsetts ska ägare till överföringssystem som ingår i vertikalt integrerade företag vara oberoendeavannanverksamhetsominteröröverföring,åtmins­ tonenärdetgällerjuridiskform,organisationochbeslutsfattande.

82

Prop. 2011/12:77

Bilaga 1

L 211/72

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

2. För att säkerställa att den ägare till överföringssystemet som avses i punkt 1 är oberoende ska följande minimikriterier gälla:

a)Personer som ansvarar för ledningen av ägaren till överfö­ ringssystemet får inte ingå i företagsstrukturer i det integre­ rade elföretag som direkt eller indirekt ansvarar för den dagliga driften när det gäller produktion, distribution eller leverans av el.

b)Lämpliga åtgärder ska vidtas för att se till att de yrkesmässiga intressena hos dem som ansvarar för ledningen av ägaren till

överföringssystemet beaktas på ett sätt som säkerställer att dessa personer kan agera självständigt.

c)Överföringssystemets ägare ska upprätta en övervaknings­ plan, där det anges vilka åtgärder som vidtagits för att mot­ verka diskriminerande beteende, och se till att det kontrolleras att planen följs. I övervakningsplanen ska det angesvilkaspecifikaskyldigheterdeanställdaharförattupp­ fylla dessa mål. Den person eller det organ som ansvarar för att övervakningsplanen följs ska till tillsynsmyndigheten lämna en årlig rapport, som ska offentliggöras, om de åtgär­ der som vidtagits.

3. Kommissionen får utfärda riktlinjer för att säkerställa att

överföringssystemets ägare i alla avseenden uppfyller villkoren i punkt 2. Dessa åtgärder, som avser att ändra icke väsentliga delar av detta direktiv genom att komplettera det, ska antas i enlighet med det föreskrivande förfarande med kontroll som avses i artikel 46.2.

Artikel 15

Inmatningsordning och balans

1.Utan att detta inverkar på leveranser av el som grundas på avtalsförpliktelser, inklusive sådana som härrör från anbudsspe­ cifikationerna, ska den systemansvarige för överföringssystemet, när den systemansvarige har denna funktion, ansvara för inmat­ ningsordningen mellan produktionsanläggningarna inom sitt område och bestämma hur sammanlänkningar till andra system ska utnyttjas.

2.Inmatningsordningen mellan produktionsanläggningarna och utnyttjandet av sammanlänkningar ska fastställas på grund­ val av kriterier som ska godkännas av de tillsynsmyndigheterna om de är behöriga och som måste vara objektiva, offentliggjorda och tillämpas på ett icke-diskriminerande sätt som säkerställer att den inre marknaden för el fungerar väl. I kriterierna ska den eko­ nomiska rangordning som gäller el från tillgängliga installationer för elproduktion, eller från överföring genom sammanlänkningar, samt de tekniska begränsningarna i systemet beaktas.

3.En medlemsstat ska ålägga de systemansvariga att, då de avgör inmatningsordningen mellan produktionsanläggningar som använder förnybara energikällor, agerar i enlighet med arti­ kel 16 i direktiv 2009/28/EG. De får också ålägga den systeman­ svarige att, då denne avgör inmatningsordningen mellan produktionsanläggningar, ge kraftvärmeverk företräde.

4.En medlemsstat får med hänsyn till försörjningstryggheten bestämma att produktionsanläggningar som använder inhemska källor för primärenergi ska prioriteras i en utsträckning som inte under något kalenderår överstiger 15 % av den totala mängd pri­ märenergi som behövs för att producera den el som förbrukas i den berörda medlemsstaten.

5.Tillsynsmyndigheterna, om medlemsstaterna föreskrivit detta, eller medlemsstaterna ska kräva att de systemansvariga för

överföringssystem uppfyller vissa minimikrav i fråga om under­ håll och utveckling av överföringssystemet, inklusive dess sammanlänkningskapacitet.

6.Systemansvariga för överföringssystem ska anskaffa den energi de behöver för att täcka energiförluster och reservkapaci­ tet inom sina system i enlighet med transparenta, icke- diskriminerande och marknadsorienterade förfaranden närhelst de har denna funktion.

7.De regler för balans av elsystemet som fastställs av system­ ansvarigaföröverföringssystemetskavaraobjektiva,transparenta och icke-diskriminerande, vilket även ska gälla för reglerna för de avgifter för obalanser i energitillförseln som tas ut av användarna avsystemansvarigasnät.Villkorochbestämmelser,inklusivereg­ ler och tariffer, för systemansvarigas tillhandahållande av sådana tjänsterskafastställaspåetticke-diskriminerandesättsomavspeg­ lar kostnaderna enligt en metod som är förenlig med artikel 37.6 och ska offentliggöras.

Artikel 16

Konfidentiell behandling när det gäller systemansvariga för överföringssystem (TSO) och ägare till överföringssystem (TSOW)

1. Utanattdetpåverkartillämpningenavartikel30ellernågon annan lagstadgad skyldighet att lämna uppgifter ska varje syste­ mansvarigförochägaretillöverföringssystembehandlakommer­ siellt känsliga uppgifter som erhålls i verksamheten konfidentiellt, och förhindra att sådana uppgifter om den egna verksamheten som kan vara kommersiellt fördelaktiga röjs på ett diskrimine­ rande sätt. Den ska i synnerhet inte röja kommersiellt känsliga uppgifterförövrigadelaravföretagetsåvidaintedettaärnödvän­ digt för att genomföra en affärstransaktion. För att efterlevnaden av reglerna om åtskillnad av information ska kunna säkerställas, ska medlemsstaterna säkerställa att överföringssystemets ägare och övriga delar av företaget inte har gemensamma funktioner, t.ex. gemensam juridisk avdelning, med undantag för rent admi­ nistrativa funktioner eller IT-funktioner.

83

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/73

 

 

 

 

2.Densystemansvarigeföröverföringssystemetfårinte,isam­ band med anknutna företags försäljning eller köp av el, missbruka kommersiellt känsliga uppgifter som erhållits från tredje part i samband med tillhandahållande av eller förhandlingar om tillträde till systemet.

3.Information som är nödvändig för en effektiv konkurrens ochenvälfungerandemarknadskaoffentliggöras.Dennaskyldig­ het påverkar inte kravet att behandla kommersiellt känsliga upp­ gifter konfidentiellt.

KAPITEL V

OBEROENDE SYSTEMANSVARIG FÖR ÖVERFÖRING (ITO)

Artikel 17

Tillgångar, utrustning, personal och identitet

1. Den oberoende systemansvarige för överföring ska vara utrustad med alla de mänskliga, tekniska, fysiska och ekonomiska resurser som är nödvändiga för att fullgöra sina skyldigheter enligt detta direktiv och bedriva elöverföringsverksamhet, särskilt följande:

a)Tillgångar som är nödvändiga för elöverföringsverksamhe­ ten, bl.a. överföringssystem, ska ägas av den oberoende sys­ temansvarige för överföring.

b)Personal som är nödvändig för elöverföringsverksamheten, bl.a. för utförande av alla verksamhetsuppgifter, ska vara anställd hos den oberoende systemansvarige för överföring.

c)Inhyrning av personal och tillhandahållande av tjänster till och från andra delar av det vertikalt integrerade företaget ska vara förbjuden. Detta ska dock inte hindra den oberoende systemansvarige för överföring från att tillhandahålla tjäns­ ter till det vertikalt integrerade företaget under förutsättning att

i)tillhandahållandet av dessa tjänster inte diskriminerar systemanvändarna, att de är tillgängliga för alla system­ användare på samma villkor och inte inskränker, sned­ vrider eller förhindrar konkurrensen avseende produktion eller leverans, och

ii)villkoren för tillhandahållandet av tjänsterna har god­ känts av tillsynsmyndigheten.

d)Utan att det påverkar tillämpningen av tillsynsorganets beslut

enligt artikel 20, ska tillräckliga ekonomiska resurser för framtida investeringsprojekt och/eller för ersättande av befintliga tillgångar göras tillgängliga för den oberoende systemansvarige för överföring i god tid av det vertikalt inte­ grerade företaget efter en vederbörlig begäran från den obe­ roende systemansvarige för överföring.

2. Elöverföringsverksamheten ska åtminstone omfatta följande uppgifter utöver dem som anges i artikel 12:

a)Företräda den oberoende systemansvarige för överföring och hålla kontakt med tredje parter och tillsynsmyndigheter.

b)Företräda den oberoende systemansvarige för överföring inom det europeiska nätverket av systemansvariga för över­ föringssystem för el (”Entso för el”).

c)Bevilja och förvalta tredje parts tillträde på ett icke- diskriminerande sätt mellan systemanvändare eller kategorier av systemanvändare.

d)Uppbära alla avgifter som härrör från överföringssystemet, bl.a. avgifter för tillträde, balansavgifter för stödtjänster, t.ex. inköp av tjänster (balanskostnader, kompensation för energiförluster).

e)Utföra drift, underhåll och utveckling av ett säkert, effektivt och ekonomiskt överföringssystem.

f)Planera investeringar för att se till att systemet på lång sikt kan tillgodose en rimlig efterfrågan och garantera säkra leveranser.

g)Inrätta lämpliga samriskföretag, bl.a. med en eller flera sys­ temansvariga för överföringssystem, elbörser och andra rele­ vanta aktörer, för att söka nå målen att vidareutveckla regionala marknader eller underlätta liberaliseringen.

h)Tillhandahålla alla typer av företagstjänster, bl.a. juridiska tjänster, redovisnings- och IT-tjänster.

3.Oberoendesystemansvarigaföröverföringssystemskaorga­ nisera sig i en juridisk form enligt artikel 1 i rådets direktiv

68/151/EEG (1).

4.Den oberoende systemansvarige för överföring får inte i sin företagsprofil, kommunikationer, firmamärke och lokaler skapa förvirring i fråga om det vertikalt integrerade företagets separata identitet eller någon del därav.

5.Den oberoende systemansvarige för överföring får inte dela IT-system eller IT-utrustning, fysiska lokaler och säkerhetssystem för åtkomst med någon del av det vertikalt integrerade företaget, och inte heller använda samma konsulter eller externa leverantö­ rer för IT-system eller IT-utrustning och säkerhetssystem för åtkomst.

6.De oberoende systemansvariga för överförings räkenskaper ska revideras av en annan revisor än den som reviderar det verti­ kalt integrerade företaget, eller någon del av detta.

(1) Rådets första direktiv 68/151/EEG av den 9 mars 1968 om samord­ ning av de skyddsåtgärder som krävs i medlemsstaterna av de i arti­ kel58andrastycketifördragetavseddabolagenibolagsmännensoch tredje mans intressen, i syfte att göra skyddsåtgärderna likvärdiga inom gemenskapen (EGT L 65, 14.3.1968, s. 8).

84

Prop. 2011/12:77

Bilaga 1

L 211/74

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

Artikel 18

Oberoende för den oberoende systemansvarige för överföring

1. Utan att det påverkar de beslut som fattas av tillsynsorganet enligt artikel 20 ska den oberoende systemansvarige för överfö­ ring ha

a)faktisk beslutanderätt, oberoende av det vertikalt integrerade företaget, när det gäller de tillgångar som är nödvändiga för att driva, underhålla eller utveckla nätet, och

b)befogenhet att anskaffa medel på kapitalmarknaden, särskilt genom lån och kapitalökning.

2.Den oberoende systemansvarige för överföring ska agera så att det säkerställs att det finns tillräckliga resurser för att bedriva överföringsverksamheten korrekt och effektivt samt för att utveckla och upprätthålla ett effektivt, säkert och ekonomiskt

överföringssystem.

3.Det vertikalt integrerade företagets dotterbolag som bedri­ verproduktions-ellerleveransverksamhetfårintedirektellerindi­ rektinnehaaktieridenoberoendesystemansvarigeföröverföring. Den oberoende systemansvarige för överföring får varken direkt eller indirekt äga aktier i något av det vertikalt integrerade företa­ gets dotterbolag som bedriver produktions- eller leveransverk­ samhet eller erhålla aktieutdelningar eller andra ekonomiska förmåner från sådana dotterbolag.

4.Den oberoende systemansvarige för överförings övergri­ pande företagsledningsstruktur och företagsform ska säkerställa ett effektivt oberoende för den oberoende systemansvarige för överföring i enlighet med detta kapitel. Det vertikalt integrerade företaget får inte direkt eller indirekt bestämma den oberoende systemansvarigeföröverföringskonkurrensbeteendeiförhållande till den oberoende systemansvarige för överförings dagliga verk­ samhet och nätförvaltning, eller i förhållande till den verksamhet som är nödvändig för att utarbeta den tioåriga nätutvecklingspla­ nen enligt artikel 22.

5.När oberoende systemansvariga för överföring fullgör sina uppgifter enligt artiklarna 12 och 17.2 i detta direktiv och när de följer artiklarna 14, 15 och 16 i förordning (EG) nr 714/2009 får de inte diskriminera olika personer eller enheter och får inte inskränka, snedvrida eller förhindra konkurrens i produktions- eller leveransverksamhet.

6.Alla kommersiella och ekonomiska förbindelser mellan det vertikalt integrerade företaget och den oberoende systemansva­ rige för överföring, bl.a. lån från den oberoende systemansvarige för överföring till det vertikalt integrerade företaget, ska ske på marknadsvillkor. Den oberoende systemansvarige för överföring ska noggrant notera sådana kommersiella och ekonomiska för­ bindelser och göra dem tillgängliga för tillsynsmyndigheten på dennas begäran.

7.Den oberoende systemansvarige för överföring ska före­ lägga för tillsynsmyndighetens godkännande alla kommersiella och ekonomiska avtal med det vertikalt integrerade företaget.

8.Den oberoende systemansvarige för överföring ska infor­ mera tillsynsmyndigheten om de ekonomiska resurser som avses i artikel 17.1 d och som finns tillgängliga för framtida investe­ ringsprojekt och/eller för att ersätta befintliga tillgångar.

9.Det vertikalt integrerade företaget ska avstå från alla hand­ lingar som försvårar för eller förhindrar den oberoende system­ ansvarige för överföring att fullgöra sina skyldigheter enligt detta kapitel och får inte kräva att den oberoende systemansvarige för överföring ska begära tillstånd från det vertikalt integrerade före­ taget för att fullgöra dessa skyldigheter.

10.Ett företag som har certifierats av tillsynsmyndigheten att det uppfyller kraven i detta kapitel ska godkännas och utses till oberoende systemansvarig för överföring av den berörda med­ lemsstaten. Certifieringsförfarandet i antingen artikel 10 i detta direktiv och artikel 3 i förordning (EG) nr 714/2009 eller i arti­ kel 11 i detta direktiv ska tillämpas.

Artikel 19

Oberoende för den oberoende systemansvarige för överförings personal och företagsledning

1.Beslutomutnämning,förlängning,arbetsvillkor,bl.a.löner, och uppsägning av personer med ansvar för företagsledning och/eller ledamöter av den oberoende systemansvarige för över­ förings administrativa organ ska fattas av den oberoende system­ ansvarigeföröverföringstillsynsorgan,somutsettsienlighetmed artikel 20.

2.Identiteten hos och de villkor som reglerar tjänsteperioden, dess varaktighet och uppsägningen för personer som utsetts av tillsynsorganet för utnämning eller förlängning såsom personer med ansvar för verkställande företagsledning och/eller ledamöter av den oberoende systemansvarige för överförings administrativa organ samt skälen till varje beslut att avsluta en sådan tjänstepe­ riod ska meddelas tillsynsmyndigheten. Dessa villkor och beslut somavsesipunkt1skaendastvarabindandeomtillsynsmyndig­ heten inom tre veckor efter underrättelsen inte har gjort några invändningar.

Tillsynsmyndigheten får göra invändningar mot de beslut som avses i punkt 1

a)om den hyser tvivel på det yrkesmässiga oberoendet hos en utsedd person som ansvarar för företagsledningen och/eller

är ledamot av något administrativt organ, eller

b)om den, vid ett förtida avbrytande av tjänsteperioden, hyser tvivel om det berättigade i ett sådant förtida avbrytande.

3. Ingen yrkesmässig position eller affärsförbindelse eller yrkesmässigt ansvar eller intresse, vare sig direkt eller indirekt, i eller med det vertikalt integrerade företaget eller någon del av detta, eller med någon annan majoritetsaktieägare än den obero­ ende systemansvarige för överföring får utövas under en treårs­ period före utnämningen av personer med ansvar för företagsledning och/eller ledamöter av den oberoende systeman­ svarige för överförings administrativa organ, vilka omfattas av denna punkt.

85

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/75

 

 

 

 

4.Personer som ansvarar för företagsledningen och/eller är ledamöter i administrativa organ samt den oberoende systeman­ svarige för överförings anställda får inte yrkesmässigt ha någon position, något ansvar, något intresse eller någon affärsförbin­ delse, vare sig direkt eller indirekt, i eller med någon annan del av det vertikalt integrerade företaget eller med dess majoritetsaktieägare.

5.Personer som ansvarar för företagsledningen och/eller är ledamöter i administrativa organ samt den oberoende systeman­ svarige för överförings anställda får inte ha något intresse eller erhålla ekonomiska förmåner, vare sig direkt eller indirekt, från någonannandelavdetvertikaltintegreradeföretagetändenobe­ roende systemansvarige för överföring. Deras lön får inte bero på det vertikalt integrerade företagets verksamhet eller resultat som inte härrör från den oberoende systemansvarige för överföring.

6.Personer som ansvarar för företagsledningen och/eller är ledamöteridenoberoendesystemansvarigeföröverföringsadmi­ nistrativa organ ska garanteras effektiv rätt att till tillsynsmyndig­ heten rikta klagomål mot förtida avbrytande av deras tjänsteperiod.

7.Efter avslutad tjänsteperiod hos den oberoende systeman­ svarigeföröverföringfårintepersonersomansvararförföretags­ ledningen och/eller är ledamöter i något av dess administrativa organ yrkesmässigt ha någon position, något ansvar, något intresse eller någon affärsförbindelse i eller med någon annan del avdetvertikaltintegreradeföretagetändenoberoendesysteman­ svarige för överföring, eller med dess majoritetsaktieägare under en period på minst fyra år.

8.Punkt 3 ska tillämpas på majoriteten av de personer som ansvarar för företagsledningen och/eller är ledamöter i det administrativa organet för den systemansvarige för överföringssystemet.

Depersonersomansvararförföretagsledningenoch/ellerärleda­ möter i det administrativa organet för den systemansvarige för

överföringssystemetochsominteomfattasavpunkt 3fårinteha utövat någon ledningsverksamhet eller någon annan relevant verksamhet i det vertikalt integrerade företaget under minst sex månader före sin utnämning.

Första stycket i denna punkt och punkterna 4–7 ska gälla samt­ liga personer som tillhör den verkställande ledningen samt dem som rapporterar direkt till dessa personer i frågor som rör drift, underhåll och utveckling av nätet.

Artikel 20

Tillsynsorgan

1. Den oberoende systemansvarige för överföring ska ha ett tillsynsorgan som ansvarar för beslut som kan ha en väsentlig inverkanpåvärdetpåaktieägarnastillgångaridenoberoendesys­ temansvarige för överföring, särskilt beslut om godkännande av de årliga och de mer långsiktiga finansieringsplanerna, den syste­ mansvariges skuldsättningsgrad och utdelningar till aktieägarna.

De beslut som faller inom tillsynsorganets ansvarsområde omfat­ tar inte sådana beslut som rör den dagliga verksamheten för den

oberoende systemansvarige för överföring och den dagliga för­ valtningen av nätet eller den verksamhet som är nödvändig för att utarbeta den tioåriga nätutvecklingsplanen enligt artikel 22.

2.Tillsynsorganet ska bestå av ledamöter som företräder det vertikalt integrerade företaget, ledamöter som företräder tredje parts aktieägare och, om så föreskrivs i någon medlemsstats lag­ stiftning, företrädare för andra intressenter såsom den oberoende systemansvarige för överförings anställda.

3.Artikel19.2förstastycketochartikel19.3–19.7skatilläm­ pas på minst hälften av tillsynsorganets ledamöter minus en.

Artikel 19.2 andra stycket b ska tillämpas på alla ledamöter i tillsynsorganet.

Artikel 21

Övervakningsplan och övervakningsansvarig

1.Medlemsstaterna ska se till att den oberoende systemansva­ rige för överföring upprättar och genomför en övervakningsplan därdetanges vilka åtgärder somvidtasföratt motverka diskrimi­ nerande beteende och på lämpligt sätt se till att planen följs. I övervakningsplanen ska det anges vilka specifika skyldigheter de anställda har för att uppfylla dessa mål. Övervakningsplanen ska underställas tillsynsmyndighetens godkännande. Utan att det påverkar tillsynsmyndighetens befogenheter ska den övervak­ ningsansvarige oberoende övervaka att planen följs.

2.Tillsynsorganet ska utse en övervakningsansvarig som ska godkännas av tillsynsmyndigheten. Tillsynsmyndigheten får vägra attgodkännadenövervakningsansvarigeendastpågrundavbris­ tande oberoende eller yrkesmässig kapacitet. Den övervaknings­

ansvarige kan vara en fysisk eller en juridisk person.

Artikel 19.2–19.8 ska tillämpas på den övervakningsansvarige.

3. Den övervakningsansvarige ska ansvara för följande åtgärder:

a)Övervaka genomförandet av övervakningsplanen.

b)Utarbeta en årsrapport om de åtgärder som vidtagits för att genomföra övervakningsplanen och överlämna den till tillsynsmyndigheten.

c)Rapportera till tillsynsorganet och utfärda rekommendatio­ ner för övervakningsprogrammet och dess genomförande.

d)Underrätta tillsynsmyndigheten alla betydande överträdelser i fråga om genomförandet av övervakningsplanen.

e)Rapportera till tillsynsmyndigheten om kommersiella och ekonomiska förbindelser mellan det vertikalt integrerade företaget och den oberoende systemansvarige för överföring.

86

Prop. 2011/12:77

Bilaga 1

L 211/76

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

4.Denövervakningsansvarigeskaföreläggatillsynsmyndighe­ ten föreslagna beslut om investeringsplanen eller om enskilda investeringar i nätet. Detta ska ske senast när företagsledningen och/eller den oberoende systemansvarige för överförings behöriga administrativa organ överlämnar dem till tillsynsorganet.

5.När det vertikalt integrerade företaget under bolagsstämman eller genom omröstning bland det utsedda tillsynsorganets leda­ möter har motsatt sig antagandet av ett beslut så att detta hindrar eller försenar investeringar, som enligt den tioåriga nätutveck­ lingsplanen skulle ha verkställts inom de följande tre åren, ska den övervakningsansvarige rapportera detta till tillsynsmyndigheten, som då ska vidta åtgärder i enlighet med artikel 22.

6.De villkor som reglerar den övervakningsansvariges upp­ drag eller anställningsvillkor, inbegripet uppdragets varaktighet, ska underställas tillsynsmyndighetens godkännande. Villkoren ska säkerställa den övervakningsansvariges oberoende, bland annat genom att förse den övervakningsansvarige med de resurser som krävs för uppdragets fullgörande. Under uppdragsperioden får denövervakningsansvarigeintehanågotannatyrkesmässigtupp­ drag, ansvar eller intresse, direkt eller indirekt, i eller med någon del av det vertikalt integrerade företaget eller dess majoritetsaktieägare.

7.Den övervakningsansvarige ska regelbundet rapportera, antingen muntligt eller skriftligt, till tillsynsmyndigheten och ska ha rätt att regelbundet rapportera, antingen muntligt eller skriftligt, till den oberoende systemansvarige för överförings tillsynsorgan.

8.Den övervakningsansvarige får delta i alla möten i den obe­ roende systemansvarige för överförings företagsledning eller administrativa organ, i tillsynsorganets möten och vid bolags­ stämman. Den övervakningsansvarige ska delta i alla möten där följande frågor diskuteras:

a)Villkor för tillträde till nätet enligt vad som föreskrivs i för­ ordning (EG) nr 714/2009 vad avser tariffer, tjänster för tillträdeförtredjepart,kapacitetstilldelning,överbelastnings­ hantering, transparens, balans och sekundärmarknader.

b)Projekt som genomförs för att driva, underhålla och utveckla

överföringssystemet, bl.a. sammanlänkningar och investe­ ringar i nätanslutningar.

c)Inköp eller försäljning av energi som krävs för överförings­ systemets drift.

9. Den övervakningsansvarige ska övervaka att den oberoende systemansvarige för överföring följer artikel 16.

11.Efter tillsynsmyndighetens godkännande får tillsynsorga­ net säga upp den övervakningsansvarige. Tillsynsorganet ska på anmodan av tillsynsmyndigheten säga upp den övervakningsan­ svarige på grund av bristande oberoende eller yrkesmässig kapacitet.

12.Den övervakningsansvarige ska ha tillgång till den obero­ ende systemansvarige för överförings kontor utan anmälan i förväg.

Artikel 22

Nätutveckling och befogenhet att fatta investeringsbeslut

1.Den oberoende systemansvarige för överföring ska varje år till tillsynsmyndigheten överlämna en tioårig nätutvecklingsplan som grundar sig på befintlig och förutsedd tillgång och efterfrå­ gan efter att ha samrått med alla berörda intressenter. Denna nät­ utvecklingsplan ska innehålla effektiva åtgärder för att garantera systemets ändamålsenlighet och säkra leveranser.

2.Den tioåriga nätutvecklingsplanen ska särskilt

a)för marknadsaktörerna ange de viktigaste överföringsinfra­ strukturer som behöver byggas ut eller uppgraderas under de kommande tio åren,

b)innehålla alla investeringar som redan beslutats och fastställa nya investeringar som ska verkställas under de kommande tre åren, och

c)ange en tidsfrist för alla investeringsprojekt.

3.När den tioåriga nätutvecklingsplanen utarbetas, ska den oberoende systemansvarige för överföring göra rimliga antagan­ den om utvecklingen av produktionen, leveranserna, förbruk­ ningen och utbytet med andra länder med beaktande av investeringsplanerna för regionala och gemenskapstäckande nät.

4.Tillsynsmyndigheten ska ha öppna och transparenta sam­ råd med alla nuvarande och potentiella systemanvändare om den tioåriganätutvecklingsplanen.Avpersonerellerföretagsomhäv­ dar att de är potentiella systemanvändare får det krävas att de underbygger sådana påståenden. Tillsynsmyndigheten ska offent­ liggöra resultatet av samrådsprocessen, särskilt eventuella investeringsbehov.

5.Tillsynsmyndigheten ska undersöka om den tioåriga nätut­ vecklingsplanen omfattar alla investeringsbehov som fastställts under samrådsprocessen och om den överensstämmer med den icke-bindande gemenskapsomfattande tioåriga nätutvecklings­ plan som avses i artikel 8.3 b i förordning (EG) nr 714/2009

(”gemenskapsomfattande nätutvecklingsplan”). Om det uppstår några tvivel om överensstämmelse med den gemenskapsomfat­

10.Den övervakningsansvarige ska ha tillgång till alla rele­ tande nätutvecklingsplanen, ska tillsynsmyndigheten samråda

vanta uppgifter och till den oberoende systemansvarige för över­ förings kontor och till all information som är nödvändig för att fullgöra sin uppgift.

med byrån. Tillsynsmyndigheten kan kräva att den systemansva­ rige för överföringssystemet ändrar sin tioåriga nätutvecklingsplan.

87

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/77

 

 

 

 

6.Tillsynsmyndighetenskaövervakaochutvärderagenomför­ andet av den tioåriga nätutvecklingsplanen.

7.För det fall den systemansvarige för överföringssystemet av någon annan orsak än tvingande orsaker som ligger utanför den­ nes kontroll, inte verkställer en investering som enligt den tioåriga nätutvecklingsplanen skulle ha verkställts inom de följande tre

åren, ska medlemsstaterna se till att tillsynsmyndigheten är skyl­ dig att vidta minst en av följande åtgärder för att säkerställa att investeringen i fråga görs, om denna investering fortfarande är relevant på grundval av den senaste tioåriga nätutvecklingsplanen:

a)Kräva att den systemansvarige för överföringssystemet verk­ ställer investeringen.

2.Den oberoende systemansvarige för överföring ska inte ha rätt att vägra ett nytt kraftverks inkoppling på grund av eventu­ ella framtida begränsningar av tillgänglig nätkapacitet, t.ex. över­ belastning i avlägsna delar av överföringssystemet. Den oberoende systemansvarige för överföring ska lämna nödvändig information.

3.Den oberoende systemansvarige för överföring ska inte ha rätt att vägra en ny anslutningspunkt på grund av att detta leder till ytterligare kostnader som uppstår vid nödvändig kapa- citetsökning i de delar av systemet som ligger närmast anslutningspunkten.

b)Anordna ett anbudsförfarande som är öppet för alla investe­ rare för investeringen.

c)Förpliktiga den oberoende systemansvarige för överföring att godta en kapitalökning för att finansiera nödvändiga inves­ teringar och tillåta oberoende investerare att delta i kapitalet.

Om tillsynsmyndigheten har utnyttjat sina befogenheter enligt första stycket b får den kräva att den oberoende systemansvarige för överföring godtar något eller några av följande alternativ, nämligen

a)finansiering av tredje part,

b)konstruktion av tredje part,

c)egen utbyggnad av den nya tillgången i fråga,

d)egen drift av den nya tillgången i fråga.

Den oberoende systemansvarige för överföring ska lämna inves­ terarna all information som behövs för att göra investeringen, ska koppla nya tillgångar till överföringsnätet och ska allmänt på bästa sätt vinnlägga sig om att underlätta genomförandet av investeringsprojektet.

Relevantafinansieringsarrangemangskaunderställastillsynsmyn­ dighetens godkännande.

8. Om tillsynsmyndigheten har utnyttjat sina befogenheter enligtpunkt7förstastycketskaderelevantatariffbestämmelserna omfatta investeringskostnaderna i fråga.

Artikel 23

Beslutsbefogenhet avseende kopplingen av nya kraftverk till överföringsnätet

1. Den oberoende systemansvarige för överföring ska inrätta och offentliggöra transparenta och effektiva förfaranden för icke- diskriminerande inkoppling av nya kraftverk till överföringssys­ temet. Dessa förfaranden ska underställas de nationella tillsynsmyndigheternas godkännande.

KAPITEL VI

DRIFT AV DISTRIBUTIONSSYSTEM

Artikel 24

Utseende av systemansvariga för distributionssystemet

Medlemsstaterna ska, för en tid som de själva bestämmer med beaktande av effektivitet och ekonomisk balans, utse eller ålägga företag som äger eller är ansvariga för distributionssystem att utse enellerflerasystemansvarigafördistributionssystemet.Medlems­ staterna ska se till att de systemansvariga för distributionssyste­ met handlar i överensstämmelse med artiklarna 25, 26 och 27.

Artikel 25

Uppgifter som åligger de systemansvariga för distributionssystemet

1.Den systemansvarige för distributionssystemet ska säker­ ställa systemets långsiktiga förmåga att uppfylla rimliga krav på eldistribution, och på affärsmässiga villkor driva, underhålla och utveckla säker, tillförlitlig och effektiv eldistribution inom sitt område, med vederbörlig hänsyn till miljön och främjandet av energieffektivitet.

2.Den systemansvarige får inte i något fall diskriminera mel­ lan systemanvändare eller kategorier av användare av systemet, i synnerhet inte till förmån för sina anknutna företag.

3.Densystemansvarigefördistributionssystemetskaförsesys­ temanvändarnameddeninformationdebehöverföreffektivttill­ träde till och användning av systemet.

4.Enmedlemsstatfåråläggadensystemansvarigefördistribu­ tionssystemet att, då denne avgör inmatningsordningen mellan produktionsanläggningar, prioritera anläggningar som använder förnybara energikällor eller avfall, eller kraftvärmeverk.

88

Prop. 2011/12:77

Bilaga 1

L 211/78

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

5. Systemansvariga för distributionssystemet ska anskaffa den energi de behöver för att täcka energiförluster och reservkapaci­ tet inom sina system i enlighet med transparenta, icke- diskriminerande och marknadsorienterade förfaranden, närhelst de har denna funktion. Detta krav ska inte påverka användningen av elektricitet som erhållits enligt avtal som ingicks före den

1 januari 2002.

6.Idetfalldesystemansvarigafördistributionssystemetansva­ rar för balans av eldistributionssystemet ska de av dem fastställda reglerna härför, inklusive regler för de avgifter för obalanser i energitillförseln som tas ut av användarna av deras nät, vara objektiva, transparenta och icke-diskriminerande. Villkor och bestämmelser, inklusive regler och tariffer, för de systemansvari­ gas tillhandahållande av sådana tjänster ska fastställas på ett icke- diskriminerande sätt som avspeglar kostnaderna enligt en metod som är förenlig med artikel 37.6 och ska offentliggöras.

7.Närdensystemansvarigeplanerarenutvecklingavdistribu­ tionsnätet ska hänsyn tas till sådana åtgärder för styrning av energieffektivitet/energiefterfrågan eller distribuerad produktion som kan komma att ersätta behovet av att uppgradera eller ersätta elkapaciteten.

Artikel 26

Åtskillnad av systemansvariga för distributionssystemet

1.Om den systemansvarige för distributionssystemet utgör en del av ett vertikalt integrerat företag ska denne åtminstone vad avser juridisk form, organisation och beslutsfattande vara obero­ ende av annan verksamhet utan samband med distribution. Dessa regler ska inte ge upphov till någon skyldighet att skilja ägandet av tillgångar i distributionssystemet från det vertikalt integrerade företaget.

2.Utöver de krav som fastställts i punkt 1 ska den systeman­ svarige för distributionssystemet, om denne utgör en del av ett vertikalt integrerat företag, med avseende på sin organisation och sitt beslutsfattande vara oberoende av annan verksamhet utan samband meddistribution. Föratt uppnå detta ska följande mini­ mikriterier gälla:

a)De personer som ansvarar för ledningen för den systeman­ svarigefördistributionssystemetfårinteingåiföretagsstruk­ turer i det integrerade elföretag som direkt eller indirekt ansvarar för den dagliga driften avseende produktion, över­ föring eller leverans av el.

b)Lämpliga åtgärder ska vidtas för att se till att de yrkesmässiga intressena hos de personer som ansvarar för ledningen för den systemansvarige för distributionssystemet beaktas på ett sätt som säkerställer att dessa personer kan agera självständigt.

c)Den systemansvarige för distributionssystemet ska ha faktisk beslutanderätt, oberoende av det integrerade elföretaget, när detgällerdetillgångarsombehövsföratttryggadrift,under­ håll eller utveckling av nätet. För detta ändamål ska den sys­ temansvarige för distributionssystemet förfoga över de resurser som krävs, inbegripet mänskliga, tekniska, fysiska

och ekonomiska resurser. Detta bör inte hindra förekomsten av lämpliga samordningsmekanismer för att säkerställa att moderbolagets ekonomiska och förvaltningsmässiga över­ vakningsrättigheter när det gäller avkastningen på tillgångar, som regleras indirekt i enlighet med artikel 37.6, i ett dotter­ bolag skyddas. Detta ska särskilt göra det möjligt för moder­ bolaget att godkänna den årliga finansieringsplan eller det motsvarande instrument somupprättas avdensystemansva­ rige för distributionssystemet och att fastställa övergripande gränser för dess dotterbolags skuldsättningsnivåer. Det ska inte vara tillåtet för moderbolaget att ge instruktioner för den dagliga driften eller om enskilda beslut beträffande uppfö­ rande eller uppgradering av distributionsnät, så länge dessa beslut inte överskrider villkoren i den godkända finansie­ ringsplanen eller motsvarande instrument.

d)Den systemansvarige för distributionssystemet ska upprätta en övervakningsplan, där det anges vilka åtgärder som vidta­ gits för att motverka diskriminerande beteende, och se till att det kontrolleras att planen följs. I övervakningsplanen ska angesvilkaspecifikaskyldigheterdeanställdaharförattupp­ fylla detta mål. Den person eller det organ som ansvarar för att övervakningsplanen följs (nedan kallad den övervaknings­ ansvarige) ska till den tillsynsmyndighet som avses i arti­ kel 35.1 överlämna en årlig rapport, som ska offentliggöras, om de åtgärder som vidtagits. Den övervakningsansvarige ska vara helt oberoende och ha tillträde till all nödvändig information om den systemansvarige för distributionssyste­ met och alla anknutna företag för att utföra sitt uppdrag.

3.Om den systemansvarige för distributionssystemet ingår i ett vertikalt integrerat företag ska medlemsstaterna se till att den­ nes verksamhet övervakas av tillsynsmyndigheterna eller andra behöriga organ, så att den systemansvarige inte kan dra fördel av sin vertikala integration för att snedvrida konkurrensen. Vertikalt integrerade systemansvariga för distributionssystem får i synner­ het inte, i samband med kommunikation och varumärkesprofile­ ring, ge upphov till förvirring i fråga om den separata identitet som leveransdelen av det vertikalt integrerade företaget har.

4.Medlemsstaternafårbeslutaattintetillämpapunkterna1,2 och 3 på integrerade elföretag som har mindre än 100 000 anslutna kunder eller levererar till små, enskilda system.

Artikel 27

Skyldighet till konfidentiell behandling för systemansvariga för distributionssystemet

Utan att det påverkar tillämpningen av artikel 30 eller någon annan lagstadgad skyldighet att lämna uppgifter ska den system­ ansvarige för distributionssystemet behandla kommersiellt käns­ liga uppgifter som denne erhåller inom ramen för sin affärsverksamhetkonfidentiellt,ochskaförhindraattsådanaupp­ gifteromdenegnaverksamhetensomkanvarakommersielltför­ delaktiga röjs på ett diskriminerande sätt.

89

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/79

 

 

 

 

Artikel 28

Slutna distributionssystem

1. Medlemsstaternafårföreskrivaattdenationellatillsynsmyn­ digheterna eller andra behöriga myndigheter klassificerar som ett slutet distributionssystem ett system som distribuerar el inom en geografiskt avgränsad industriell eller kommersiell plats eller plats där gemensamma tjänster tillhandahålls och som inte, utan att det påverkar tillämpningen av punkt 4, levererar el till hushållskun­ der, såvida

a)driften eller produktionsprocessen hos systemanvändarna är integrerad av särskilda tekniska skäl eller säkerhetsskäl, eller

b)systemet distribuerar el huvudsakligen till ägaren av eller den driftsansvarige för systemet eller till företag med anknytning till ägaren av eller den driftsansvarige för systemet.

utsträckning som krävs för att de ska kunna utföra sina uppgifter ha tillgång till elföretagens räkenskaper i enlighet med artikel 31.

2. Medlemsstaterna och varje utsedd behörig myndighet, inklusivetillsynsmyndigheterna,skabehandlakommersielltkäns­ liga uppgifter konfidentiellt. Medlemsstaterna får föreskriva att sådan information offentliggörs om detta är nödvändigt för att de behöriga myndigheterna ska kunna utföra sina uppgifter.

Artikel 31

Särredovisning

2. Medlemsstaternafårföreskrivaattdenationellatillsynsmyn­ digheterna undantar den driftsansvarige för ett slutet distribu­ tionssystem från

a)skyldigheten i artikel 25.5 att anskaffa energi för att täcka energiförluster och reservkapacitet inom sitt system i enlig­ het med transparenta, icke-diskriminerande och marknads­ baserade förfaranden,

b)skyldigheteniartikel32.1atttarifferna,ellerdemetodersom använts för att beräkna dem, är godkända innan de träder i kraft i enlighet med artikel 37.

3.Vid beviljandet av undantag enligt punkt 2 ska de gällande tarifferna, eller de metoder som använts för att beräkna dem, på begäran av en användare av det slutna distributionssystemet, ses

över och godkännas i enlighet med artikel 37.

4.Undantag enligt punkt 2 ska även kunna beviljas för tillfäl­ lig användning av ett litet antal hushåll som har anställning hos eller liknande koppling till ägaren till distributionssystemet och som befinner sig inom det område som får el levererad genom ett slutet distributionssystem.

Artikel 29

Kombinerat systemansvar

Artikel 26.1 ska inte hindra verksamheten för en systemansvarig med kombinerat ansvar för överförings- och distributionssyste­ men, under förutsättning att denne systemansvarige följer arti­ kel 9.1, eller artiklarna 13 och 14, eller kapitel V, eller omfattas av artikel 44.2.

KAPITEL VII

SÄRREDOVISNING AV OLIKA VERKSAMHETER SAMT

TRANSPARENS I BOKFÖRINGEN

Artikel 30

Tillgång till räkenskaper

1. Medlemsstaterna eller varje behörig myndighet de utser, inklusive de tillsynsmyndigheter som avses i artikel 35, ska i den

1.Medlemsstaterna ska vidta de åtgärder som är nödvändiga för att säkerställa att elföretagens bokföring genomförs i enlighet med punkterna 2 och 3.

2.Elföretagska,oberoendeavägartypellerjuridiskform,upp­ rätta, låta revidera och offentliggöra sina årsredovisningar i enlig­ het med de bestämmelser i nationell lagstiftning som avser årsredovisning för aktiebolag och som har fastställts i enlighet med rådets fjärde direktiv 78/660/EEG av den 25 juli 1978 grun­ dat på artikel 44.2 g (*) i fördraget om årsbokslut i vissa typer av bolag (1).

Företag som inte enligt lag är skyldiga att offentliggöra sin årsre­ dovisning ska hålla en kopia av denna tillgänglig för allmänheten på sitt huvudkontor.

3.Elföretag ska i sin interna bokföring särredovisa överförings- och distributionsverksamheten var för sig så som de skulle behöva göraomverksamheterna bedrevs avseparataföretag, för attund­ vika diskriminering, korssubventionering och snedvridning av konkurrensen. De ska också redovisa, eventuellt genom en sam­ manställd redovisning, andra elverksamheter utan samband med överföring eller distribution. Fram till den 1 juli 2007 ska de sär­ redovisa leveranserna till berättigade kunder och leveranserna till icke-berättigade kunder. Inkomster från äganderätt till

överförings- eller distributionssystemet ska specificeras i bokfö­ ringen. Vid behov ska de upprätta en sammanställd redovisning för annan verksamhet utanför elsektorn. Den interna bokföringen ska omfatta en balansräkning och en resultaträkning för varje verksamhetsgren.

4.Den revision som anges i punkt 2 ska särskilt verifiera att den i punkt 3 angivna skyldigheten att undvika diskriminering och korssubventioner uppfylls.

(*) Rubriken på direktiv 78/660/EEG har anpassats för att ta hänsyn till omnumreringen av artiklarna i fördraget om upprättandet av Europe­ iska gemenskapen i enlighet med artikel 12 i Amsterdamfördraget. Den ursprungliga hänvisningen gjordes till artikel 54.3 g.

(1) EGT L 222, 14.8.1978, s. 11.

90

Prop. 2011/12:77

Bilaga 1

L 211/80

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

KAPITEL VIII

ORGANISATION AV TILLTRÄDE TILL SYSTEMET

Artikel 32

Tillträde för tredje part

1. Medlemsstaterna ska se till att det införs en ordning för tredje parts tillträde till överförings- och distributionssystemen grundad på offentliggjorda tariffer, som ska gälla för alla berättigade kunder samttillämpasobjektivtochutanattnågondiskriminerandeåtskill­ nad görs mellan systemanvändarna. Medlemsstaterna ska se till att dessa tariffer, eller de metoder som använts för att beräkna dem, är godkända innan de träder i kraft i enlighet med artikel 37 samt att tarifferna–ochmetodernaomendastdessahargodkänts –offent­ liggörs innan de träder i kraft.

b)får kommissionen, med beaktande av situationen på mark­ naden och det gemensamma intresset, i de fall där en trans­ aktion som omfattas av led a vägrats på grund av att kunden är berättigad endast i det ena av de båda systemen, ålägga den vägrande parten att verkställa den begärda leveransen på begäran av den medlemsstat där den berättigade kunden är belägen.

Artikel 34

Direktledningar

1. Medlemsstaterna ska vidta de åtgärder som är nödvändiga för att göra det möjligt för

a)alla elproducenter och elhandlare som är etablerade inom derasterritoriumattlevereratillsinaegnafastigheter,dotter­ bolag och berättigade kunder genom en direktledning, och

2. Den systemansvarige för överförings- eller distributionssys­ temet får vägra tillträde till systemet om det saknar nödvändig kapacitet. Vederbörligen motiverade skäl, som särskilt tar hänsyn till artikel 3 och som grundas på objektiva och tekniskt och eko­ nomiskt motiverade kriterier, måste anges för en sådan vägran. Tillsynsmyndigheterna, om medlemsstaterna föreskrivit detta, eller medlemsstaterna ska se till att dessa kriterier tillämpas kon­ sekvent och att en systemanvändare som vägrats tillträde har till­ gång till ett tvistlösningsförfarande. Vid behov, och om tillträde till systemet har vägrats, ska tillsynsmyndigheterna också se till att den systemansvarige för överförings- eller distributionssystemet tillhandahåller relevant information om vilka åtgärder som skulle krävas för att förstärka nätet. Den part som begär sådan informa­ tion får åläggas en rimlig avgift för att täcka kostnaderna för till­ handahållande av informationen.

Artikel 33

Öppnande av marknaderna och ömsesidighet

1. Medlemsstaterna ska se till att följande kunder är berättigade:

a)Fram till den 1 juli 2004, de berättigade kunder som avses i artikel 19.1–19.3 i direktiv 96/92/EG. Medlemsstaterna ska senast den 31 januari varje år offentliggöra kriterierna för fastställandet av vilka dessa berättigade kunder är.

b)Från och med den 1 juli 2004, samtliga icke-hushållskunder.

c)Från och med den 1 juli 2007, samtliga kunder.

2. För att undvika bristande jämvikt när elmarknaderna öppnas

a)får avtal om leverans av el med en berättigad kund inom en annan medlemsstats system inte förbjudas, om kunden anses berättigad i båda de berörda systemen, och

b)alla berättigade kunder inom deras territorium att få leveran­ ser via en direktledning från ett producentföretag och en elhandlare.

2.Medlemsstaterna ska fastställa kriterier för beviljandet av tillstånd att uppföra direktledningar inom deras territorium. Dessa kriterier ska vara objektiva och icke-diskriminerande.

3.Möjligheten att leverera el genom en direktledning enligt punkt 1 i den här artikeln ska inte påverka möjligheten att ingå elavtal i enlighet med artikel 32.

4.Medlemsstaterna får göra tillståndet att uppföra en direkt­ ledning avhängigt antingen av att tillträde till systemet har vägrats på grundval av artikel 32, eller av att ett tvistlösningsförfarande enligt artikel 37 har inletts.

5.Medlemsstaternafårvägraattmeddelatillståndtillendirekt­ ledning om ett sådant tillstånd skulle strida mot bestämmelserna i artikel 3. Vederbörligen motiverade skäl ska anges för en sådan vägran.

KAPITEL IX

NATIONELLA TILLSYNSMYNDIGHETER

Artikel 35

Tillsynsmyndigheternas utnämning och oberoende

1.Varje medlemsstat ska utse en nationell tillsynsmyndighet på nationell nivå.

2.Punkt 1 ska inte påverka utnämningen av andra tillsyns­ myndigheter på regional nivå i medlemsstaterna, förutsatt att det finns en företrädare på hög nivå för representation och kontakt på gemenskapsnivå i den tillsynsnämnd som ingår i byrån i enlighet med artikel 14.1 i förordning (EG) nr 713/2009.

91

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/81

 

 

 

 

3.Genomundantagfrånpunkt1kanenmedlemsstatutsetill­ synsmyndigheter för mindre system på ett geografiskt separat område vars konsumtion 2008 understiger 3 % av den samlade konsumtionen i den medlemsstat där området är beläget. Detta undantag ska inte påverka utnämningen av en företrädare på hög nivå för representation och kontakt på gemenskapsnivå i den till­ synsnämnd som ingår i byrån i enlighet med artikel 14.1 i för­ ordning (EG) nr 713/2009.

4.Medlemsstaternaskagaranteratillsynsmyndighetensobero­ ende och säkerställa att den utövar sina befogenheter på ett opar­ tiskt och transparent sätt. I detta syfte ska medlemsstaterna se till att tillsynsmyndigheten, när den utför de uppgifter som den till­ delas i enlighet med detta direktiv och tillhörande lagstiftning,

a)är juridiskt åtskild från och funktionellt oberoende av alla andra offentliga och privata organ,

b)att dess personal och de personer som svarar för dess ledning

i)agerar oberoende av marknadsintressen, och

ii)inte söker eller tar emot direkta anvisningar från någon regering eller annat offentligt eller privat organ när de utför sina tillsynsuppgifter. Detta krav inkräktar inte i förekommande fall på ett nära samarbete med andra berörda nationella myndigheter eller på de allmänna politiska riktlinjer som regeringen utfärdat och som inte avser tillsynsskyldigheter och tillsynsbefogenheter enligt artikel 37.

5. För att bevara tillsynsmyndighetens oberoende ställning ska medlemsstaterna i synnerhet se till

a)att tillsynsmyndigheten kan fatta självständiga beslut obero­ ende av något politiskt organ och har särskilda årliga bud­ getanslag med självständigt ansvar för den anslagna budgetensgenomförandeochtillräckligapersonellaocheko­ nomiska resurser för att kunna utföra sina uppgifter, och

b)att ledamöterna av tillsynsmyndighetens styrelse eller, om sådan inte finns, tillsynsmyndighetens högsta ledning utses för en bestämd period på mellan fem och sju år, som ska kunna förnyas en gång.

Med avseende på första stycket b ska medlemsstaterna se till att det finns ett lämpligt roterande system för styrelsen eller högsta ledningen.Styrelsensledamötereller,omstyrelseintefinns,med­ lemmar av högsta ledningen kan avsättas endast om de inte längre uppfyller villkoren i denna artikel eller har gjort sig skyldiga till fel enligt nationell lag.

Artikel 36

Tillsynsmyndighetens allmänna mål

När tillsynsmyndigheten utför de uppgifter som anges i detta direktiv ska den vidta alla rimliga åtgärder för att bidra till följande mål inom ramen för sina skyldigheter och befogenheter enligt artikel 37, i förekommande fall i samarbete med andra relevanta nationella myndigheter, inklusive konkurrensmyndigheterna, och utan att inkräkta på deras behörighet:

a)I nära samarbete med byrån, andra medlemsstaters tillsyns­ myndigheter och kommissionen främja en konkurrenskraf­ tig, säker och miljömässigt hållbar inre marknad för el i gemenskapen och ett verkligt öppnande av marknaden för samtliga kunder och elhandlare i gemenskapen, och se till att det råder lämpliga villkor för att elnäten ska kunna fungera effektivt och tillförlitligt med beaktande av de långsiktiga målen.

b)Utveckla konkurrenskraftiga och väl fungerande regionala marknader inom gemenskapen för att de mål som avses i led a ska kunna uppnås.

c)Undanröja restriktioner för elhandeln mellan medlemsstater, utveckla den kapacitet för gränsöverskridande överföring som rimligen krävs för att tillgodose efterfrågan och förbättra integreringen av nationella marknader som kan underlätta för elflödet inom hela gemenskapen.

d)Bidra till att det så kostnadseffektivt som möjligt utvecklas säkra, pålitliga, effektiva och icke-diskriminerande system som är konsumentinriktade, samt främja systemens tillräck­ lighet och, i linje med de allmänna energipolitiska målsätt­ ningarna, främja energieffektivitet och integrering i både överförings- och distributionsnäten av stor- och småskalig produktion av el från förnybara energikällor och distribuerad produktion.

e)Underlätta tillträde till elnätet för ny produktionskapacitet, i synnerhetgenomattundanröjahindersomskullekunnaför­ hindra tillträdet för nya marknadsaktörer och för el produ­ cerad från förnybara energikällor.

f)Säkerställa att systemansvariga och systemkunder får lämp­ liga incitament, både på kort och lång sikt, för att öka syste­ meffektiviteten och främja marknadsintegreringen.

g)Säkerställaattkundernadrarnyttaavattdeninhemskamark­ naden fungerar effektivt, främja effektiv konkurrens och bidra till att säkerställa konsumentskyddet.

h)Bidra till uppnåendet av en hög standard på samhällsomfat­ tande och allmännyttiga tjänster på elförsörjningens område, bidra till skydd för utsatta kunder, samt bidra till att de pro­ cesser för utbyte av uppgifter som behövs då kunder byter elhandlare är kompatibla.

92

Prop. 2011/12:77

Bilaga 1

L 211/82

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

Artikel 37

Tillsynsmyndighetens skyldigheter och befogenheter

1.Tillsynsmyndigheten ska ha följande skyldigheter:

a)Fastställa eller godkänna, enligt transparenta kriterier,

överförings-ellerdistributionstarifferellermetoderförberäk­ ning av dem.

b)Säkerställa att systemansvariga för och, i förekommande fall,

ägare av överförings- och distributionssystem, liksom elföre­ tag, fullgör sina skyldigheter enligt detta direktiv samt övrig relevant gemenskapslagstiftning, inbegripet i fråga om gränsöverskridande aspekter.

c)Samarbeta om gränsöverskridande frågor med tillsynsmyn­ dighetenellertillsynsmyndigheternaideandraberördamed­ lemsstaterna och med byrån.

d)Följa och genomföra de rättsligt bindande och relevanta beslut som fattats av byrån och kommissionen.

e)Lämna in en årlig rapport om sin verksamhet och om hur dess skyldigheter har fullgjorts till de berörda myndigheterna

imedlemsstaterna, byrån och kommissionen. Rapporten ska omfatta de åtgärder som vidtagits och de resultat som upp­ nåtts med avseende på samtliga de uppgifter som räknas upp

idenna artikel.

f)Förhindra korssubventionering inom verksamhetsgrenarna överföring, distribution och leverans.

g)Övervaka de investeringsplaner som de systemansvariga för

överföringssystem utarbetar och i sin årsrapport presentera en bedömning av i vilken mån dessa investeringsplaner är förenliga med den gemenskapsomfattande nätutvecklings­ plansomavsesiartikel8.3biförordning(EG)nr714/2009, varvid bedömningen får innefatta rekommendationer om ändring av dessa investeringsplaner.

h)Övervaka efterlevnaden av reglerna för nätens säkerhet och tillförlitlighet,seöverhurreglernaefterlevtstidigareochfast­ ställa eller godkänna normer och krav på tjänsternas och leveransernas kvalitet eller bidra till detta tillsammans med andra behöriga myndigheter.

i)Övervaka graden av transparens, också i grossistpriser, och säkerställa att elföretagen fullgör sina skyldigheter vad gäller transparens.

j)Övervaka graden och effektiviteten av marknadsöppnande och konkurrens på grossist- och konsumentnivå, även när det gäller elbörser, priser för hushållskunder, inklusive sys­ tem för förskottsbetalning, andel kunder som byter elhand­ lare, andel kunder som får sina leveranser avstängda, avgifterna för och utförandet av underhållstjänster och hus­ hållskundernas klagomål, samt övervaka eventuell snedvrid­ ning eller inskränkning av konkurrensen, och tillhandahålla relevant information, och göra de berörda konkurrensmyn­ digheterna uppmärksamma på relevanta fall.

k)Övervaka förekomsten av begränsande avtalsvillkor, däri­ bland exklusivitetsklausuler, som kan hindra större icke- hushållskunder från att teckna avtal med mer än en elhandlare samtidigt eller begränsa deras möjligheter att göra detta och, om så är lämpligt, underrätta de nationella kon­ kurrensmyndigheterna om sådana avtalsvillkor.

l)Respektera avtalsfriheten, både för avtal som kan avbrytas och för långtidsavtal, förutsatt att dessa stämmer överens med gemenskapslagstiftningen och gemenskapens politik.

m)Övervaka den tid som överförings- och distributionsföreta­ gen behöver för att genomföra sammanlänkningar och reparationer.

n)Tillsammans med andra relevanta myndigheter bidra till att konsumentskyddsåtgärderna, inklusive åtgärderna i bilaga I,

är effektiva och genomförs.

o)Minst en gång per år offentliggöra rekommendationer om leveransavgifternas överensstämmelse med artikel 3 och vid behov översända dessa rekommendationer till konkurrensmyndigheterna.

p)Säkerställa tillgången till kundernas förbrukningsuppgifter, tillhandahållandetföralternativanvändningavettlättbegrip­ ligt harmoniserat format på nationell nivå för förbruknings­ uppgifter och omedelbar tillgång för alla kunder till sådana uppgifter enligt led h i bilaga I.

q)Övervakagenomförandetavregleromuppgifterochskyldig­ heter för systemansvariga för överföringssystem och distri­ butionssystem, elhandlare och kunder samt andra marknadsaktörer enligt förordning (EG) nr 714/2009;

r)Övervaka investeringarna i produktionskapacitet med avse­ ende på försörjningstryggheten.

s)Övervaka tekniskt samarbete mellan gemenskapen och tred­ jeländers systemansvariga för överföringssystemet.

t)Övervakagenomförandetavskyddsåtgärderenligtartikel42.

u)Bidra till inbördes överensstämmelse av processer för utbyte avuppgifteromdeviktigastemarknadsprocessernapåregio­ nal nivå.

2. Om så är föreskrivet i en medlemsstat får de övervaknings­ uppgifter som avses i punkt 1 utföras av andra myndigheter än tillsynsmyndigheten. I sådana fall ska den information som är resultatet av övervakningen göras tillgänglig för tillsynsmyndig­ heten så snart som möjligt.

Utan att inkräkta på den specifika behörighet den har och i över­ ensstämmelsemedprincipernaombättrelagstiftningskatillsyns­ myndigheten, samtidigt som den bevarar sin självständighet, vid behov rådgöra med systemansvariga för överföringssystemen och, när så är lämpligt, nära samarbeta med andra relevanta nationella myndigheter när de fullgör de uppgifter som anges i punkt 1.

93

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/83

 

 

 

 

Eventuella godkännanden som ges av en tillsynsmyndighet eller byrån i enlighet med detta direktiv ska inte påverka dess veder­ börligen motiverade framtida användning av sina befogenheter enligt denna artikel eller sanktioner som åläggs av andra berörda myndigheter eller kommissionen.

3. Förutom de skyldigheter som tillsynsmyndigheten tilldelas enligt punkt 1 ska den, när en oberoende systemansvarig har utsetts enligt artikel 13,

a)övervaka att överföringssystemets ägare och den oberoende systemansvarige fullgör sina skyldigheter enligt den här arti­ keln samt besluta om sanktioner då skyldigheterna inte full­ görs i enlighet med punkt 4 d,

b)övervaka förbindelser och kommunikation mellan den obe­ roende systemansvarige och överföringssystemets ägare för att säkerställa att den oberoende systemansvarige fullgör sina skyldigheter, och särskilt godkänna avtal samt agera som tvistlösande myndighet mellan den oberoende systemansva­ rige och överföringssystemets ägare vid klagomål som läm­ nats av någondera parten i enlighet med punkt 11,

c)utanattdetpåverkarförfarandetenligtartikel13.2c,förden första tioåriga nätutvecklingsplanen, godkänna den investe­ ringsplaneringochdenfleråriganätutvecklingsplansompre­ senteras årligen av den oberoende systemansvarige,

d)se till att tariffer för tillträde till nät som tas ut av oberoende systemansvariga inkluderar en ersättning till nätägaren eller nätägarna som ger en adekvat ersättning för användning av nättillgångarna samt för eventuella nyinvesteringar däri, för­ utsatt att de gjorts på ett ekonomiskt och effektivt sätt,

e)habefogenhetattutförainspektioner,ävenoanmäldasådana, i lokaler som tillhör överföringssystemets ägare och de obe­ roende systemansvariga, och

f)övervaka användningen av kapacitetsavgifter som tas ut av den oberoende systemansvarige i enlighet med artikel 16.6 i förordning (EG) nr 714/2009.

4. Medlemsstaterna ska säkerställa att tillsynsmyndigheterna får befogenheter att kunna utföra de skyldigheter som anges i punkterna 1, 3 och 6 på ett effektivt och snabbt sätt. För detta

ändamål ska tillsynsmyndigheten åtminstone få befogenheter att

a)fatta bindande beslut om elföretag,

b)göra undersökningar av elmarknadernas funktion och att besluta om och införa nödvändiga och proportionerliga åtgärder för att främja effektiv konkurrens och säkerställa att

marknaden fungerar korrekt; vid behov ska tillsynsmyndig­ heten också ha befogenhet att samarbeta med den nationella konkurrensmyndigheten och tillsynsmyndigheterna för finansmarknaden eller kommissionen när undersökningen gäller konkurrenslagstiftningen,

c)begära den information från elföretagen som är relevant för utförandet av dess uppgifter, bland annat skäl till vägran att ge tredje part tillträde och uppgifter om åtgärder som krävs för att stärka nätet,

d)besluta om effektiva, proportionerliga och avskräckande sanktioner för elföretag som inte fullgör sina skyldigheter enligt detta direktiv eller enligt relevanta och rättsligt bin­ dandebeslutsomfattatsavtillsynsmyndigheternaellerbyrån, eller att föreslå en behörig domstol att besluta om sådana sanktioner; detta ska inbegripa befogenhet att besluta om ellerattföreslåattdetbeslutasomsanktionerpåupptill10 % av den systemansvariges årliga omsättning eller på upp till 10 % av det vertikalt integrerade företagets årliga omsätt­ ning för den systemansvarige för överföringssystemet eller detvertikaltintegreradeföretaget,alltefteromständigheterna, för att de inte uppfyllt sina skyldigheter enligt detta direktiv, och

e)göra erforderliga undersökningar och relevanta befogenhe­ ter vad gäller instruktioner för tvistlösning enligt punk­ terna 11 och 12.

5. Utöver de skyldigheter och befogenheter som tilldelats till­ synsmyndighetenenligtpunkterna1och4närenoberoendesys­ temansvarig för överföring har utsetts i enlighet med kapitel V, ska tillsynsmyndigheten ha åtminstone följande uppgifter och befogenheter:

a)Besluta om sanktioner enligt punkt 4 d för diskriminerande beteende till förmån för det vertikalt integrerade företaget.

b)Övervaka kommunikationerna mellan den systemansvarige för överföringssystemet och det vertikalt integrerade företa­ get i syfte att se till att den systemansvarige uppfyller sina skyldigheter.

c)Agera som tvistlösande myndighet mellan det vertikalt inte­ grerade företaget och den systemansvarige för överförings­ systemet vad avser klagomål som framförts enligt punkt 11.

d)Övervaka kommersiella och ekonomiska förbindelser, bl.a. lån mellan det vertikalt integrerade företaget och den syste­ mansvarige för överföringssystemet.

e)Godkänna alla kommersiella och ekonomiska avtal mellan det vertikalt integrerade företaget och den systemansvarige för

överföringssystemet,påvillkorattdeföljermarknadsvillkoren.

94

Prop. 2011/12:77

Bilaga 1

L 211/84

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

f)Begära motivering av det vertikalt integrerade företaget när detanmältsavdenövervakningsansvarigeenligtartikel21.4. Sådanmotivering skasärskiltinnehålla bevispåattinget dis­ kriminerande beteende har skett till förmån för det vertikalt integrerade företaget.

g)Utföra inspektioner, även oanmälda sådana, i det vertikalt integrerade företagets och den systemansvariges lokaler.

h)Överlåta den systemansvariges alla eller specifika uppgifter på en oberoende systemansvarig som utsetts i enlighet med artikel 13 när den systemansvarige upprepade gånger inte uppfyllt sina skyldigheter enligt detta direktiv, särskilt vid upprepat diskriminerande beteende till förmån för det verti­ kalt integrerade företaget.

6. Tillsynsmyndigheterna ska ansvara för att tillräckligt lång tid iförväginnandessaträderikraft,fastställaellergodkännaåtmins­ tone metoder för att beräkna eller fastställa villkoren för

a)anslutning och tillträde till nationella nät, inklusive

överförings- och distributionstariffer eller deras beräknings­ metoder;dessatarifferellermetoderskautformassåattnöd­ vändiga investeringar i näten kan göras på ett sätt som gör det möjligt att säkra nätens funktion,

b)tillhandahållande av balanstjänster, vilka ska utföras så eko­ nomiskt som möjligt och ge nätanvändarna goda incitament för nätanvändarna att balansera sin inmatning och sitt uttag; balanstjänsterna ska tillhandahållas rättvist och utan diskri­ minering och bygga på objektiva kriterier, och

c)tillträde till gränsöverskridande infrastruktur, inbegripet för­ faranden för kapacitetstilldelning och hantering av överbelastning.

7.Metoderna eller villkoren som avses i punkt 6 ska offentliggöras.

8.När det gäller fastställande eller godkännande av tariffer eller metoderochavbalanstjänsternaskatillsynsmyndigheternasäker­ ställa att de systemansvariga för överförings- och distributions­ systemen både på kort och lång sikt ges lämpliga incitament att öka effektiviteten, främja integrationen av marknaden och säkra leveranser samt stödja forskningsverksamheten på området.

9.Tillsynsmyndigheterna ska övervaka hur överbelastningssi­ tuationer hanteras inom nationella elnät och sammanlänkningar och hur reglerna för hantering av överbelastning tillämpas. För detta ändamål ska de systemansvariga för överföringssystemen eller marknadsaktörerna översända sina regler för hantering av överbelastning, inbegripet kapacitetstilldelning, till de nationella tillsynsmyndigheterna. De nationella tillsynsmyndigheterna får begära ändringar av dessa regler.

10.Tillsynsmyndigheterna ska ha befogenhet att vid behov begära att de systemansvariga för överförings- och distributions­ systemen ändrar villkoren, inbegripet de tariffer eller metoder som avses i denna artikel, för att säkerställa att de är proportio­ nerliga och tillämpas på ett icke-diskriminerande sätt. I händelse av att fastställandet av överförings- och distributionstariffer för­ senas ska tillsynsmyndigheterna ha befogenhet att fastställa eller godkänna preliminära överförings- och distributionstariffer, eller metoder härför, och att fatta beslut om lämpliga kompensations­

åtgärder om de slutliga tarifferna eller metoderna skiljer sig från dessa preliminära tariffer eller metoder.

11.Varje part som har ett klagomål mot en systemansvarig för

överförings- eller distributionssystemet vad avser den systeman­ svariges skyldigheter i enlighet med detta direktiv får inge klago­ målet till tillsynsmyndigheten, som i egenskap av tvistlösande myndighet ska fatta ett beslut inom två månader från det att kla­ gomålet mottagits. Denna period får förlängas med två månader om tillsynsmyndigheten begär ytterligare upplysningar. Den för­ längda perioden får förlängas ytterligare om den klagande sam­ tycker till detta. Ett sådant beslut ska vara bindande så länge det inte har upphävts vid ett överklagande.

12.Varje berörd part som har rätt att inge klagomål mot ett beslut om metoder som fattats i enlighet med denna artikel eller, om tillsynsmyndigheten är skyldig att samråda, mot de föreslagna tarifferna eller metoderna, får senast inom två månader efter offentliggörandet av beslutet eller förslaget till beslut, eller inom en kortare tidsperiod om medlemsstaterna föreskriver detta, inge ett klagomål för behandling. Ett sådant klagomål ska inte utgöra hinder för verkställighet.

13.Medlemsstaterna ska inrätta lämpliga och effektiva meka­ nismer för reglering, kontroll och transparens för att förhindra missbruk av en dominerande ställning, särskilt om det är till kon­ sumenternas nackdel, och underprissättning. Dessa mekanismer ska beakta bestämmelserna i fördraget, särskilt artikel 82.

14.Medlemsstaterna ska se till att lämpliga åtgärder, inbegri­ petadministrativaåtgärderellerstraffrättsliga förfaranden ienlig­ het med nationell lagstiftning, vidtas mot ansvariga fysiska eller juridiska personer när de bestämmelser om konfidentialitet som föreskrivs i detta direktiv inte har följts.

15.Klagomålenligtpunkterna11och12skaintepåverkarät­ ten att överklaga enligt gemenskapsrätten eller den nationella lagstiftningen.

16.Tillsynsmyndighetens beslut ska vara fullt motiverade för attmedgedomstolsprövning.Beslutenskavaratillgängligaförall­ mänheten samtidigt som den konfidentiella karaktären hos kom­ mersiellt känsliga uppgifter ska bevaras.

95

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/85

 

 

 

 

17. Medlemsstaterna ska setill att det finns lämpliga mekanis­ mer på nationell nivå som ger den part som berörs av ett beslut fattat av en tillsynsmyndighet rätt att överklaga till ett organ som är oberoende av de berörda parterna och av någon regering.

Artikel 38

Regelverk för gränsöverskridande frågor

1.Tillsynsmyndigheterna ska nära samråda och samarbeta medvarandra,ochskabiståvarandraochbyrånmedsådaninfor­ mation som krävs för att de ska kunna fullgöra sina uppgifter enligt detta direktiv. När det gäller den information som utbyts skadenmottagandemyndighetensäkerställasammagradavkon­ fidentialitet som den som krävs av den myndighet som lämnade informationen.

2.Tillsynsmyndigheterna ska samarbeta åtminstone regionalt för att

a)främja skapandet av operativa arrangemang för att möjlig­ göra en optimal näthantering, främja gemensamma elbörser ochfördelagränsöverskridandekapacitet,liksomförattmöj­ liggöra en adekvat nivå på sammanlänkningskapaciteten, inbegripet genom ny sammanlänkning, inom regionen och mellan regioner så att en effektiv konkurrens kan utvecklas och leveranssäkerheten kan förbättras, utan diskriminering mellan leveransföretagen i de olika medlemsstaterna,

b)samordna utvecklingen av alla nätföreskrifter som gäller för relevanta systemansvariga för överföringssystemet och för andra marknadsaktörer, och

c)samordna utvecklingen av regler för hanteringen av överbelastning.

3.De nationella tillsynsmyndigheterna ska ha rätt att ingå samarbetsarrangemang med varandra i syfte att främja tillsynssamarbetet.

4.De åtgärder som avses i punkt 2 ska vid behov vidtas i nära samråd med andra berörda nationella myndigheter utan att detta påverkar deras specifika befogenheter.

5.Kommissionen får anta riktlinjer om i vilken utsträckning tillsynsmyndigheterna är skyldiga att samarbeta med varandra och med byrån. Dessa åtgärder, som avser att ändra icke väsent­ liga delar av detta direktiv genom att komplettera det, ska antas i enlighet med det föreskrivande förfarande med kontroll som avses i artikel 46.2.

Artikel 39

Överensstämmelse med riktlinjerna

1. Varje tillsynsmyndighet och kommissionen får begära ett yttrande från byrån angående huruvida ett beslut som fattats av en tillsynsmyndighet överensstämmer med de riktlinjer som avses i detta direktiv eller i förordning (EG) nr 714/2009.

2.Byrån ska inom tre månader från dagen för mottagandet av begäran avge sitt yttrande till den tillsynsmyndighet som har begärt det eller till kommissionen och till den tillsynsmyndighet som har fattat det aktuella beslutet.

3.Om den tillsynsmyndighet som har fattat beslutet inte föl­ jer byråns yttrande inom fyra månader från dagen för mottagan­ det av yttrandet ska byrån informera kommissionen härom.

4.Varje tillsynsmyndighet får informera kommissionen om den anser att ett beslut som fattats av en annan tillsynsmyndighet och som är relevant för gränsöverskridande handel inte överens­ stämmermedderiktlinjersomavsesidettadirektivelleriförord­ ning (EG) nr 714/2009 inom två månader räknat från dagen för det beslutet.

5.Omkommissionen,inomtvåmånaderefteratthainforme­ ratsavbyrånienlighetmedpunkt3elleraventillsynsmyndighet i enlighet med punkt 4 eller på eget initiativ inom tre månader från dagen för beslutet, finner att det beslut som fattats av en till­ synsmyndighet ger anledning till allvarliga tvivel beträffande dess förenlighet med de riktlinjer som avses i detta direktiv eller i för­ ordning (EG) nr 714/2009, får kommissionen besluta att under­ söka ärendet ytterligare. Kommissionen ska i sådana fall uppmana tillsynsmyndigheten och parterna i förfarandet hos tillsynsmyn­ digheten att yttra sig.

6.Om kommissionen beslutar att undersöka ärendet ytterli­ gare ska den inom fyra månader från dagen för beslutet fatta ett slutgiltigt beslut om att

a)inte göra några invändningar mot tillsynsmyndighetens beslut, eller

b)begära att den berörda tillsynsmyndigheten ändrar eller åter­ kallar sitt beslut på grund av att riktlinjerna inte har följts.

7.Om kommissionen inte beslutar att undersöka ärendet ytterligare eller inte fattar något slutgiltigt beslut inom den tids­ gräns som fastställs i punkt 5 respektive punkt 6 ska det anses att den inte haft några invändningar mot tillsynsmyndighetens beslut.

8.Tillsynsmyndigheten ska följa kommissionens beslut att

återkalla beslutet inom två månader, och ska informera kommis­ sionen om detta.

9.Kommissionen får anta riktlinjer för det förfarande som ska följas vid tillämpningen av denna artikel. Dessa åtgärder, som avser att ändra icke väsentliga delar av detta direktiv genom att komplettera det, ska antas i enlighet med det föreskrivande förfa­ rande med kontroll som avses i artikel 46.2.

96

Prop. 2011/12:77

Bilaga 1

L 211/86

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

Artikel 40

Bevarande av information

1.Medlemsstaterna ska kräva att elhandlare under minst fem år håller relevanta uppgifter om samtliga transaktioner gällande elleveransavtal och elderivat med grossister och systemansvariga för överföringssystemet tillgängliga för de nationella myndighe­ terna, inklusive de nationella tillsynsmyndigheterna, de nationella konkurrensmyndigheterna och kommissionen, för fullgörandet av deras uppgifter.

2.Uppgifterna ska innehålla information om relevanta trans­ aktioner, såsom regler om löptid, tillhandahållande och fullgö­ rande samt information om mängd, datum och tider för verkställande, transaktionspriser och metoder för att identifiera den berörda grossisten liksom specificerad information om alla elleveransavtal och elderivat som inte fullgjorts.

3.Tillsynsmyndigheten får besluta att göra delar av denna information tillgänglig för marknadsaktörer, förutsatt att kom­ mersiellt känslig information om enskilda marknadsaktörer eller individuellatransaktionerintelämnasut.Dennapunktfårintetil­ lämpas på information om finansiella instrument som omfattas av direktiv 2004/39/EG.

4.För att säkerställa en enhetlig tillämpning av denna artikel får kommissionen anta riktlinjer som fastställer metoder och vill­ kor för bevarande av information liksom form och innehåll när det gäller de uppgifter som ska bevaras. Dessa åtgärder, som avser att ändra icke väsentliga delar av detta direktiv genom att kom­ plettera det, ska antas i enlighet med det föreskrivande förfarande med kontroll som avses i artikel 46.2.

5.När det gäller transaktioner avseende elderivat mellan elhandlare, å ena sidan, och grossister och systemansvariga för överföringssystemet, å andra sidan, ska denna artikel tillämpas först när kommissionen har antagit de riktlinjer som avses i punkt 4.

6.Bestämmelserna i denna artikel får inte skapa ytterligare skyldigheteriförhållandetilldemyndighetersomavsesipunkt1 för de enheter som omfattas av direktiv 2004/39/EG.

7.Om de myndigheter som avses i punkt 1 behöver tillgång till de uppgifter som innehas av enheter som omfattas av direktiv

2004/39/EG, ska de ansvariga myndigheterna enligt det direkti­ vet tillhandahålla dem de begärda uppgifterna.

KAPITEL X

KUNDMARKNADER

Artikel 41

Kundmarknader

För att underlätta utvecklingen av välfungerande och transparenta kundmarknader för el i gemenskapen, ska medlemsstaterna se till att rollerna och ansvarsområdena för systemansvariga för

överföringssystem, systemansvariga för distribution, elhandlare och kunder samt vid behov andra aktörer på marknaden fastställs med avseende på avtalsvillkor, åtaganden mot kunder, regler för utbyte av uppgifter och betalning, äganderätt till uppgifter och mätningsansvar.

Dessa regler ska offentliggöras och utformas i syfte att underlätta kundernas och elhandlarnas nättillträde och granskas av tillsyns­ myndigheterna eller andra relevanta nationella myndigheter.

Större icke-hushållskunder ska ha rätt att ingå avtal med flera leverantörer samtidigt.

KAPITEL XI

SLUTBESTÄMMELSER

Artikel 42

Skyddsåtgärder

Ihändelseavenplötsligkrispåenergimarknadenellerifallavhot mot personers, anordningars eller anläggningars fysiska trygghet ellersäkerhetellermotettkraftsystemsintegritet,fårenmedlems­ stat tillfälligt vidta nödvändiga skyddsåtgärder.

Sådana åtgärder ska orsaka minsta möjliga störning av den inre marknadens funktion och får inte vara mer omfattande än vad som är absolut nödvändigt för att avhjälpa de plötsliga svårighe­ ter som har uppstått.

Den berörda medlemsstaten ska utan dröjsmål anmäla dessa åtgärder till övriga medlemsstater och till kommissionen, som får besluta att den berörda medlemsstaten ska ändra eller upphäva sådanaåtgärder,idenutsträckningsomdesnedvriderkonkurren­ sen och negativt påverkar handeln på ett sätt som står i strid med det gemensamma intresset.

Artikel 43

Lika villkor

1.De åtgärder som medlemsstaterna vidtar för att säkerställa lika villkor i enlighet med detta direktiv ska vara förenliga med fördraget, särskilt artikel 30, och gemenskapslagstiftningen.

2.De åtgärder som avses i punkt 1 ska vara proportionerliga, icke-diskriminerande och transparenta. Dessa åtgärder får bara vidtas efter anmälan till kommissionen och med kommissionens medgivande.

3.Kommissionen ska reagera på den anmälan som avses i punkt 2 inom två månader efter anmälans mottagande. Denna period ska börja dagen efter det att fullständig information har erhållits. Om kommissionen inte handlat inom denna tvåmåna­ dersperiod,skadetansesattkommissioneninteharnågrainvänd­ ningar mot de anmälda åtgärderna.

97

 

 

 

Prop. 2011/12:77

 

 

 

Bilaga 1

14.8.2009

 

Europeiska unionens officiella tidning

L 211/87

SV

 

 

 

 

 

 

Artikel 44

Artikel 46

 

 

Undantag

Kommitté

1. Medlemsstater som efter det att detta direktiv har trätt i kraft kan visa att det har uppstått påtagliga problem för driften av deras små, enskilda system får till kommissionen ansöka om undantag från tillämpliga bestämmelser i kapitlen IV, VI, VII och VIII, samt kapitel III, till förmån för enskilda mikrosystem, i fråga om reno­ vering, uppgradering och utvidgning av befintlig kapacitet, vilka fårbeviljasavkommissionen.Kommissionenskaunderrättamed­ lemsstaterna om dessa ansökningar innan den fattar beslut, med beaktandeavrespektenförkonfidentialitet.Beslutetskaoffentlig­ göras i Europeiska unionens officiella tidning.

1.Kommissionen ska biträdas av en kommitté.

2.När det hänvisas till denna punkt ska artiklarna 5a.1–5a.4 och7ibeslut1999/468/EGtillämpas,medbeaktandeavbestäm­ melserna i artikel 8 i det beslutet.

Artikel 47

Rapportering

2. Artikel 9 ska inte gälla Cypern, Luxemburg och/eller Malta. Dessutom ska inte heller artiklarna 26, 32 och 33 gälla Malta.

I artikel 9.1 b ska begreppet ”företag som bedriver produktions- eller leveransverksamhet” inte omfatta slutförbrukare som bedri­ ver verksamhet inom produktion och/eller leverans av el, antingen direkt eller genom ett företag som de utövar kontroll över, antingen enskilt eller gemensamt med någon annan, förutsatt att slutförbrukarna, inbegripet deras andel av el som produceras i kontrollerade företag, är nettoförbrukare av el uttryckt i årligt genomsnitt och förutsatt att det ekonomiska värdet av den el som de säljer till tredje part är obetydligt i förhållande till deras övriga affärsverksamhet.

Artikel 45

Granskningsförfarande

Omkommissionenidenrapportsomavsesiartikel47.6drarden slutsatsen, mot bakgrund av det sätt på vilket tillträde till nätet faktiskt har genomförts i en medlemsstat – vilket ger upphov till fullt effektivt, icke-diskriminerande och obehindrat nättillträde – att vissa skyldigheter som företag åläggs i enlighet med detta direktiv (inklusive skyldigheterna när det gäller åtskillnad i rätts­ ligt avseende för systemansvariga för distributionssystemet) inte står i proportion till det mål som eftersträvas, får den berörda medlemsstaten av kommissionen anhålla om befrielse från kravet i fråga.

Medlemsstaten ska omedelbart underrätta kommissionen om denna begäran och lämna all den relevanta information som är nödvändig för att visa att den slutsats som dragits i rapporten om att effektivt nättillträde säkerställs kommer att kvarstå.

Inom tre månader efter det att kommissionen har underrättats ska den ta ställning till den berörda medlemsstatens begäran och vid behov lägga fram förslag för Europaparlamentet och rådet om att

ändra de relevanta bestämmelserna i detta direktiv. Kommissio­ nen får i förslagen om att ändra direktivet föreslå att den berörda medlemsstaten undantas från särskilda krav under förutsättning att denna medlemsstat vid behov vidtar lika effektiva åtgärder.

1. Kommissionen ska övervaka och se över tillämpningen av detta direktiv och ska senast den 4augusti2004och därefter varje år, överlämna en övergripande rapport till Europaparlamentet och rådet om de framsteg som gjorts. Rapporten om framsteg ska omfatta åtminstone följande:

a)Erfarenheter och framsteg som gjorts när det gäller att skapa en fullbordad och fullt ut fungerande inre marknad för el och de hinder som kvarstår för att uppnå detta mål, t.ex. i form av dominerande marknadsställning, koncentrationer på marknaden, underprissättning och beteenden som motver­ karkonkurrenssamtdeeffekterdettahariformavsnedvrid­ ningar på marknaden.

b)I vilken utsträckning kraven på åtskillnad och särredovisning och tariffering i detta direktiv har lett till att tillträdet till gemenskapens elnät blivit rättvist och icke-diskriminerande och till att likvärdiga konkurrensnivåer har uppnåtts, samt vilka ekonomiska, miljömässiga och sociala följder öppnan­ det av elmarknaden fått för kunderna.

c)En analys av frågor rörande systemens kapacitetsnivå och försörjningstrygghet när det gäller el i gemenskapen, särskilt den rådande och förväntade balansen mellan tillgång och efterfrågan, med beaktande av den fysiska kapaciteten för överföring mellan olika områden.

d)Särskild uppmärksamhet kommer att ägnas de åtgärder som vidtagits i medlemsstaterna för att täcka efterfrågetoppar och hantera brister i leveranser från en eller flera elhandlares sida.

e)Genomförandet av undantaget som föreskrivs i artikel 26.4 i syfte att eventuellt revidera tröskeln.

f)En allmän bedömning av de framsteg som gjorts inom ramen fördebilateralaförbindelsernameddetredjeländersompro­ ducerar och exporterar eller transporterar el, inbegripet vilka framsteg dessa länder har gjort när det gäller integration av marknaden, de sociala och miljömässiga konsekvenserna av handel med el och tillträde till näten.

98

Prop. 2011/12:77

Bilaga 1

L 211/88

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

g)Behovetaveventuellaharmoniseringskravsominteärkopp­ lade till bestämmelserna i detta direktiv.

h)Det sätt på vilket medlemsstaterna i praktiken har genomfört kraven om energimärkning i artikel 3.9, och det sätt på vil­ ket eventuella rekommendationer från kommissionen i denna fråga har beaktats.

Rapporten om framsteg får vid behov innehålla rekommendatio­ ner, särskilt när det gäller räckvidden och villkoren för bestäm­ melsernaommärkning,tillexempelhurdethänvisastillbefintliga referenskällor och innehållet i dessa källor samt särskilt om hur informationen om den inverkan på miljön som elframställning från olika energikällor har, åtminstone när det gäller utsläpp av CO2 och radioaktivt avfall, skulle kunna göras tillgänglig på ett sätt som är transparent och lättillgängligt samt möjliggör jämfö­ relser inom gemenskapen, och om hur de åtgärder som vidtagits i medlemsstaterna för att kontrollera tillförlitligheten hos den informationsomtillhandahållitsavelhandlareskullekunnaratio­ naliseras, och vilka åtgärder som skulle kunna motverka negativa effekter av dominerande marknadsställning och marknadskoncentration.

2.Vartannat år ska den rapport om framsteg som avses i punkt1ävenomfattaenanalysavdeolikaåtgärdersomvidtagits i medlemsstaterna för att uppfylla skyldigheter när det gäller all­ männyttiga tjänster,samtenbedömning avdessaåtgärderseffek­ tivitet och, i synnerhet, deras inverkan på konkurrensen på elmarknaden.Rapportenfårvidbehovinnehållarekommendatio­ ner om vilka åtgärder som bör vidtas på nationell nivå för att uppnå en hög kvalitet på de allmännyttiga tjänsterna eller för att förhindra en avskärmning av marknaden.

3.Kommissionen ska senast den 3 mars 2013 som en del av den allmänna översynen förelägga Europaparlamentet och rådet en detaljerad särskild rapport om i vilken utsträckning kraven på

åtskillnad enligt kapitel V med framgång har kunnat säkerställa fullt och effektivt oberoende för de oberoende systemansvariga föröverföring,medfaktiskocheffektivåtskillnadsomriktmärke.

4.Förkommissionensbedömningenligtpunkt3skakommis­ sionen särskilt beakta följande kriterier: rättvist och icke- diskriminerandetillträdetillnätet,effektivreglering,utvecklingav nätet för att tillgodose marknadens behov, icke snedvridna inves­ teringsincitament, utveckling av sammanlänkningsinfrastruktur, effektiv konkurrens på gemenskapens energimarknader och säkra leveranser i gemenskapen.

5.När så är lämpligt och särskilt för det fall det i den detalje­ rade särskilda rapport som avses i punkt 3 fastställs att villkoren enligtpunkt4inteharsäkerställtsipraktiken, skakommissionen lämna förslag till Europaparlamentet och rådet för att säkerställa fullt och effektivt oberoende för de systemansvariga för överfö­ ringssystemen senast den 3 mars 2014.

6. Kommissionen ska senast den 1januari2006överlämna en detaljerad rapport till Europaparlamentet och rådet om framste­ gen när det gäller att skapa en inre marknad för el. I rapporten ska särskilt redovisas

förekomsten av icke-diskriminerande nättillträde,

fungerande tillsyn,

utvecklingen av infrastrukturen för sammanlänkning och läget beträffande försörjningstryggheten i gemenskapen,

i vilken utsträckning de fullständiga fördelarna av att mark­ naden öppnas tillfaller små företag och hushållskunder, sär­ skilt i fråga om kvaliteten på de samhällsomfattande och allmännyttiga tjänsterna,

i vilken utsträckning marknaderna i praktiken är öppna för verklig konkurrens, inbegripet aspekter som rör domine­ randemarknadsställning,marknadskoncentration,underpris­ sättning eller beteende som motverkar konkurrens,

ivilkenutsträckningkundernaverkligenbyterelhandlareoch omförhandlar tariffer,

prisutveckling, inbegripet leveransavgifterna, i förhållande till i hur stor utsträckning marknaderna öppnas, och

deerfarenhetersomvunnitsvidtillämpningenavdettadirek­ tiv vad gäller det verkliga oberoendet för systemansvariga i vertikaltintegreradeföretagochhuruvidaandraåtgärderutö­ ver funktionellt oberoende och särredovisning har utvecklats vilkas effekt är likvärdig med rättslig åtskillnad.

DådetärlämpligtskakommissionenläggaframförslagförEuro­ paparlamentet och rådet, i synnerhet för att garantera hög kvali­ tet på de allmännyttiga tjänsterna.

DådetärlämpligtskakommissionenläggaframförslagförEuro­ paparlamentet och rådet, i synnerhet för att säkerställa fullstän­ digt och faktiskt oberoende för de systemansvariga för distributionssystemet före den 1 juli 2007. Vid behov ska dessa förslag, i överensstämmelse med konkurrenslagstiftningen, även avse åtgärder angående dominerande marknadsställning, mark­ nadskoncentrationochunderprissättningellerbeteendesommot­ verkar konkurrensen.

Artikel 48

Upphävande

Direktiv 2003/54/EG ska upphöra att gälla från och med den 3mars2011utan att det påverkar medlemsstaternas förpliktelser när det gäller tidsfrister för införlivande och tillämpning av nämnda direktiv. Hänvisningar till det upphävda direktivet ska ansessomhänvisningartilldethärdirektivetochskaläsasienlig­ het med jämförelsetabellen i bilaga II.

99

 

 

 

Prop. 2011/12:77

 

 

 

Bilaga 1

14.8.2009

 

Europeiska unionens officiella tidning

L 211/89

SV

 

 

 

 

 

 

Artikel 49

Artikel 50

 

 

Införlivande

Ikraftträdande

1. Medlemsstaterna ska sätta i kraft de lagar och andra författ­ ningar som är nödvändiga för att följa detta direktiv senast den 3 mars 2011. De ska genast underrätta kommissionen om detta.

Detta direktiv träder i kraft den tjugonde dagen efter det att det har offentliggjorts i Europeiska unionens officiella tidning.

De ska tillämpa dessa bestämmelser från och med den 3 mars

2011, med undantag av artikel 11, som de ska tillämpa från och med den 3 mars 2013.

När en medlemsstat antar dessa bestämmelser ska de innehålla en hänvisning till detta direktiv eller åtföljas av en sådan hänvisning när de offentliggörs. Närmare föreskrifter om hur hänvisningen ska göras ska varje medlemsstat själv utfärda.

2. Medlemsstaterna ska till kommissionen överlämna texten till de centrala bestämmelser i nationell lagstiftning som de antar inom det område som omfattas av detta direktiv.

Artikel 51

Adressater

Detta direktiv riktar sig till medlemsstaterna.

Utfärdat i Bryssel den 13 juli 2009.

 

På Europaparlamentets vägnar

På rådets vägnar

H.-G. PÖTTERING

E. ERLANDSSON

Ordförande

Ordförande

100

Prop. 2011/12:77

Bilaga 1

L 211/90

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

BILAGA I

KONSUMENTSKYDDSÅTGÄRDER

1.Om inte annat följer av gemenskapsreglerna om konsumentskydd, särskilt Europaparlamentets och rådets direktiv 97/7/EG av den 20 maj 1997 om konsumentskydd vid distansavtal (1) och rådets direktiv 93/13/EEG av den 5april1993om oskäliga villkor i konsumentavtal (2),skadeåtgärdersomavsesiartikel3tillförsäkrakundernaföljande:

a)Rätt till ett avtal med sin elhandlare, i vilket följande anges:

Elhandlarens namn och adress.

De tjänster som tillhandahålls, kvalitet på de tjänster som erbjuds och tidpunkt för den ursprungliga inkopplingen.

De underhållstjänster som tillhandahålls.

På vilket sätt aktuell information om tariffer och underhållskostnader kan erhållas.

Avtaletslöptidochhuravtaletochtjänsternaförlängsellersägsuppsamthuruvidadetskavaratillåtetattfrån­ träda ett avtal utan kostnad.

Villkoren för ersättning och återbetalning om tjänsterna inte håller angiven kvalitet, inbegripet i händelse av inkorrekt eller försenad fakturering.

Hur det tvistlösningsförfarande som avses i led f inleds.

Information om konsumentens rättigheter, inbegripet behandlingen av klagomål och all den information som avses i denna punkt, tydligt angiven på räkningen eller elföretagens webbplatser.

Villkoren ska vara skäliga och kända på förhand. Information om dem bör under alla omständigheter ges innan avtalet ingås eller bekräftas. Om avtal ingås genom en mellanhand ska de upplysningar som avses i denna punkt också tillhandahållas innan avtalet ingås.

b)Underrättelseigodtidomvarjeavsiktattändraavtalsvillkorenochisambandmeddennaunderrättelseupplysning om att kunderna har rätt att frånträda avtalet. Elhandlarna ska på ett transparent och lättbegripligt sätt underrätta sina kunder direkt om varje avgiftshöjning, vid lämplig tidpunkt som inte infaller senare än en normal fakture­ ringsperiod efter det att höjningen trätt i kraft. Medlemsstaterna ska se till att kunder har möjlighet att frånträda avtal om de inte godtar de nya villkor som elhandlaren meddelat.

c)Transparent information om priser, tariffer och standardvillkor för tillgång till och utnyttjande av eltjänster.

d)Brett val av betalningssätt, som inte får medföra oskälig diskriminering mellan olika kunder. Eventuella system för förskottsbetalningar ska vara skäliga och adekvat återspegla den sannolika elförbrukningen. Alla skillnader i villkor och bestämmelser ska motsvara elhandlarens kostnader för de olika betalningssystemen. De allmänna villkoren ska varaskäligaochtransparenta.Deskameddelaspåettklartochlättbegripligtspråkochfårinteomfattasådanahin­ derförkonsumenternasutövandeavsinarättighetersominteföljerdirektavavtalet,tillexempelattavtalenäronö­ digt omfattande. Kunderna ska skyddas mot oskäliga eller vilseledande försäljningsmetoder.

e)Möjlighet att byta elhandlare utan kostnad.

(1) EGT L 144, 4.6.1997, s. 19. (2) EGT L 95, 21.4.1993, s. 29.

101

Prop. 2011/12:77

Bilaga 1

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/91

 

 

 

 

f)Tillgång till transparenta, okomplicerade och billiga förfaranden för behandling av kundernas klagomål. Alla kun­ der ska framför allt ha rätt till en god standard på både tillhandahållandet av tjänster och behandlingen av klagomål från sin elhandlares sida. Sådana förfaranden för tvistlösning utanför domstol ska göra det möjligt att lösa tvister snabbt och rättvist, helst inom tre månader, och när det är befogat ska de innefatta ett system för återbetalning och/eller ersättning. Förfarandena bör i möjligaste mån följa de principer som anges i kommissionens rekommen­ dation 98/257/EG av den 30 mars 1998 om principer som ska tillämpas på de instanser som är ansvariga för för­ faranden för reglering av konsumenttvister utanför domstol (1).

g)Information om sina rättigheter när det gäller samhällsomfattande tjänster om de har tillgång till samhällsomfat­ tande tjänster enligt de bestämmelser som medlemsstaterna antagit i enlighet med artikel 3.3.

h)Tillgång till sina förbrukningsuppgifter och möjlighet att genom uttryckligt avtal och utan kostnad ge registrerade leveransföretagtillgångtillsinamätaruppgifter.Denpartsomansvararförhanteringenavuppgifternaskavaraskyl­ dig att lämna ut dessa uppgifter till företaget. Medlemsstaterna ska fastställa uppgifternas format och ett förfarande för elhandlare och konsumenter för att få tillgång till uppgifterna. Inga ytterligare kostnader ska åläggas konsu­ menten för denna tjänst.

i)Klar och tydlig information om den faktiska elförbrukningen och faktiska elkostnader tillräckligt ofta, så att de kan reglerasinegenelförbrukning.Informationenskalämnasinomenrimligtidsfristsombeaktarkapacitetenhoskun­ dens mätningsutrustning och elprodukten i fråga. Vederbörlig hänsyn ska tas till sådana åtgärders kostnadseffek­ tivitet. Inga ytterligare kostnader får åläggas konsumenten för denna tjänst.

j)Slutavräkning efter varje byte av elhandlare senast sex veckor efter det att bytet skett.

2.Medlemsstaterna ska se till att det genomförs system med smarta mätare som hjälper konsumenterna att aktivt med­ verka på elmarknaden. Genomförandet av dessa mätsystem kan göras till föremål för en ekonomisk bedömning av alla kostnader och all nytta de för med sig för marknaden på lång sikt och den enskilda konsumenten eller av vad slags smarta mätare som är ekonomiskt rimliga och kostnadseffektiva och vilken tidsfrist som är rimlig för deras distribution.

En sådan bedömning ska göras senast den 3 september 2012.

Med utgångspunkt i denna bedömning ska medlemsstaterna, eller ett behörigt organ som de utser, ta fram en tidsplan med ett mål på upp till 10 år för genomförandet av system med smarta mätare.

Omuppsättningenavsmartamätarebedömsvaraenframgångskaminst80procentavkonsumenternasenast2020 ha ett intelligent mätarsystem.

Medlemsstaterna, eller en behörig myndighet som de utser, ska se till att de mätarsystem som ska tas i bruk på deras territorier är driftskompatibla samt ta vederbörlig hänsyn till lämpliga standarder och bästa praxis samt vikten av att det utvecklas en gemensam elmarknad.

(1) EGT L 115, 17.4.1998, s. 31.

102

 

 

 

 

 

Prop. 2011/12:77

 

 

 

 

 

Bilaga 1

L 211/92

 

 

Europeiska unionens officiella tidning

14.8.2009

 

SV

 

 

 

 

 

 

 

 

 

 

BILAGA II

 

 

 

 

 

 

JÄMFÖRELSETABELL

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Direktiv 2003/54/EG

 

Detta direktiv

 

 

 

 

 

 

 

 

 

 

 

Artikel 1

 

Artikel 1

 

 

 

 

 

 

 

 

 

 

 

Artikel 2

 

Artikel 2

 

 

 

 

 

 

 

 

 

 

 

Artikel 3

 

Artikel 3

 

 

 

 

 

 

 

 

 

 

 

Artikel 4

 

Artikel 4

 

 

 

 

 

 

 

 

 

 

 

Artikel 5

 

Artikel 5

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 6

 

 

 

 

 

 

 

 

 

 

 

Artikel 6

 

Artikel 7

 

 

 

 

 

 

 

 

 

 

 

Artikel 7

 

Artikel 8

 

 

 

 

 

 

 

 

 

 

 

Artikel 10

 

Artikel 9

 

 

 

 

 

 

 

 

 

 

 

Artikel 8

 

Artikel 10

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 11

 

 

 

 

 

 

 

 

 

 

 

Artikel 9

 

Artikel 12

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 13

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 14

 

 

 

 

 

 

 

 

 

 

 

Artikel 11

 

Artikel 15

 

 

 

 

 

 

 

 

 

 

 

Artikel 12

 

Artikel 16

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 17

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 18

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 19

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 20

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 21

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 22

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 23

 

 

 

 

 

 

 

 

 

 

 

Artikel 13

 

Artikel 24

 

 

 

 

 

 

 

 

 

 

 

Artikel 14

 

Artikel 25

 

 

 

 

 

 

 

 

 

 

 

Artikel 15

 

Artikel 26

 

 

 

 

 

 

 

 

 

 

 

Artikel 16

 

Artikel 27

 

 

 

 

 

 

 

 

 

 

 

Artikel 17

 

Artikel 29

 

 

 

 

 

 

 

 

 

 

 

Artikel 18

 

Artikel 30

 

 

 

 

 

 

 

 

 

 

 

Artikel 19

 

Artikel 31

 

 

 

 

 

 

 

 

 

 

 

Artikel 20

 

Artikel 32

 

 

 

 

 

 

 

 

 

 

 

Artikel 21

 

Artikel 33

 

 

 

 

 

 

 

 

 

 

 

Artikel 22

 

Artikel 34

 

 

 

 

 

 

 

 

 

 

Artikel 23.1 första och andra meningen

 

Artikel 35

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 36

 

 

 

 

 

 

 

 

 

 

 

Artikel 23 (resten)

 

Artikel 37

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 38

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 39

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 40

 

 

 

 

 

 

 

 

 

 

 

 

Artikel 41

 

 

 

 

 

 

 

 

 

 

 

Artikel 24

 

Artikel 42

 

 

 

 

 

 

 

 

103

 

 

 

 

 

Prop. 2011/12:77

 

 

 

 

 

Bilaga 1

14.8.2009

 

 

Europeiska unionens officiella tidning

 

L 211/93

 

SV

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Direktiv 2003/54/EG

 

Detta direktiv

 

 

 

 

 

 

 

 

 

 

 

Artikel 43

 

 

 

 

 

 

 

 

 

 

Artikel 25

 

 

 

 

 

 

 

 

 

 

 

Artikel 26

 

Artikel 44

 

 

 

 

 

 

 

 

 

 

Artikel 27

 

Artikel 45

 

 

 

 

 

 

 

 

 

 

 

Artikel 46

 

 

 

 

 

 

 

 

 

 

Artikel 28

 

Artikel 47

 

 

 

 

 

 

 

 

 

 

Artikel 29

 

Artikel 48

 

 

 

 

 

 

 

 

 

 

Artikel 30

 

Artikel 49

 

 

 

 

 

 

 

 

 

 

Artikel 31

 

Artikel 50

 

 

 

 

 

 

 

 

 

 

Artikel 32

 

Artikel 51

 

 

 

 

 

 

 

 

 

 

Bilaga A

 

Bilaga I

 

 

 

 

 

 

 

104

Europaparlamentets och rådets direktiv 2009/73/EG av den 13 juli 2009

L 211/94

SV

Europeiska unionens officiella tidning

Prop. 2011/12:77

Bilaga 2

14.8.2009

EUROPAPARLAMENTETS OCH RÅDETS DIREKTIV 2009/73/EG av den 13 juli 2009

om gemensamma regler för den inre marknaden för naturgas och om upphävande av direktiv

2003/55/EG

(Text av betydelse för EES)

EUROPAPARLAMENTET OCH EUROPEISKA UNIONENS RÅD HAR ANTAGIT DETTA DIREKTIV

med beaktande av fördraget om upprättandet av Europeiska gemenskapen, särskilt artiklarna 47.2, 55 och 95,

med beaktande av kommissionens förslag,

med beaktande av Europeiska ekonomiska och sociala kommit­ téns yttrande (1),

med beaktande av Regionkommitténs yttrande (2),

i enlighet med förfarandet i artikel 251 i fördraget (3), och

av följande skäl:

(1)Den inre marknaden förnaturgas, somstegvis hargenom­ förts i hela gemenskapen sedan 1999, syftar till att skapa faktiska valmöjligheter för alla kunder i Europeiska unio­ nen, både enskilda och företag, nya affärsmöjligheter och ökad handel över gränserna, vilket ska leda till ökad effek­ tivitet, konkurrenskraftiga priser, högre kvalitet på tjäns­ terna och bidra till försörjningstrygghet och hållbarhet.

(2)Europaparlamentets och rådets direktiv 2003/55/EG av den 26 juni 2003 om gemensamma regler för den inre marknaden för naturgas (4) har i hög grad bidragit till att skapa en sådan inre marknad för naturgas.

(3)De friheter som Europeiska unionens medborgare garan­ terasgenomfördraget–blandannatfrirörlighetförvaror, etableringsfrihetenochfrihetenatttillhandahållatjänster– kan endast uppnås på en fullständigt öppnad marknad, där allakonsumenterfrittkanväljahandlareochdärallahand­ lare kan leverera fritt till sina kunder.

(4)Det föreligger emellertid för närvarande hinder mot att sälja gas på lika villkor och utan diskriminering eller nack­ delarigemenskapen.Framföralltfinnsdetännuintenågot icke-diskriminerande nättillträde eller någon myndighets­ tillsyn som är lika effektiv i alla medlemsstater.

(1) EUT C 211, 19.8.2008, s. 23. (2) EUT C 172, 5.7.2008, s. 55.

(3) Europaparlamentets yttrande av den 9juli2008(ännuejoffentliggjort i EUT), rådets gemensamma ståndpunkt av den 9 januari 2009

(EUT C 70 E, 24.3.2009, s. 37) och Europaparlamentets ståndpunkt av den 22 april 2009 (ännu ej offentliggjord i EUT). Rådets beslut av den 25 juni 2009.

(4) EUT L 176, 15.7.2003, s. 57.

(5)I kommissionens meddelande av den 10januari2007med titeln ”En energipolitik för Europa” framhävdes betydelsen avattfullbordadeninremarknadenförnaturgasochskapa lika villkor för alla naturgasföretag i gemenskapen. Kom­ missionens meddelanden av den 10 januari 2007 ”Om utsikterna för den inre el- och gasmarknadenoch Utred­ ning i enlighet med artikel 17 i förordning (EG) nr 1/2003 avdeeuropeiskagas-ochelsektorerna(slutrapport) visade att nuvarande regler och åtgärder inte tillhandahåller den ram som krävs för att målet om en välfungerande inre marknad ska kunna uppnås.

(6)Utan effektiv åtskillnad mellan näten och verksamheter som rör produktion och leverans (”effektiv åtskillnad”), finns det en risk för diskriminering, inte bara i samband mednätdriftenutanävennärdetgällerincitamentenförde vertikalt integrerade företagen att göra de investeringar i näten som krävs.

(7)Dereglerförrättsligochfunktionellåtskillnadsomangesi direktiv 2003/55/EG har emellertid inte medfört någon effektiv åtskillnad av systemansvariga för överföringssys­ tem. Därför uppmanades kommissionen vid Europeiska rådets möte den 8–9 mars 2007 att utarbeta lagförslag för effektiv åtskillnad mellan leverans och produktion, å ena sidan, och nätverksamhet, å andra sidan.

(8)Effektiv åtskillnad kan bara säkras genom att man undan­ röjer incitamentet för vertikalt integrerade företag att dis­ kriminera konkurrenterna i samband med nättillträde och investeringar. Åtskilt ägande, vilket innebär att nätägaren utsestillsystemansvarigochattnätägarenäroberoendeav leverans- eller produktionsintressen, är helt klart en effek­ tiv och stabil metod för att lösa inbyggda intressekonflik­ ter och säkra försörjningstryggheten. Europaparlamentet hänvisar därför i sin resolution av den 10 juli 2007 om utsikterna för den inre gas- och elmarknaden (5) till åtskilt ägande på överföringsnivå som det effektivaste verktyget för att främja investeringar i infrastruktur på ett icke- diskriminerande sätt och garantera ett rättvist nättillträde för nya aktörer och transparens på marknaden. Vid åtskilt

ägande bör det därför ställas krav på medlemsstaterna att säkerställa att en eller flera personer inte kontrollerar ett produktions- eller gashandelsföretag samtidigt som den eller de utövar kontroll över eller rättigheter gentemot en

(5) EUT C 175 E, 10.7.2008, s. 206.

105

Prop. 2011/12:77

Bilaga 2

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/95

 

 

 

 

systemansvarig för överföringssystemet eller ett överfö­ ringssystem. Omvänt bör kontroll över ett överföringssys­ tem eller en systemansvarig för överföringssystemet utesluta möjligheten att utöva kontroll över eller någon rättighet gentemot ett produktionsföretag eller ett gashan­ delsföretag.Inomdessabegränsningarbörettproduktions­ företag eller ett gashandelsföretag kunna inneha en minoritetsandel iensystemansvarig förettöverföringssys­ tem eller ett överföringssystem.

(9)Ett system för åtskillnad bör effektivt undanröja eventuella intressekonflikter mellan producenter, handlare och syste­ mansvariga för överföringssystem för att skapa incitament för nödvändiga investeringar och trygga nya marknadsak­ törers tillträde inom ramen för ett transparent och effek­ tivt regelverk samt bör inte skapa ett regelverk som är alltför betungande för de nationella tillsynsmyndigheterna.

(10)Definitionen av begreppet kontroll är hämtad från rådets förordning (EG) nr 139/2004 av den 20 januari 2004 om kontroll av företagskoncentrationer (EG:s koncentrationsförordning) (1).

(11)Eftersom åtskilt ägande i vissa fall innebär att företag måste omstruktureras,bördemedlemsstatersombeslutarattför­ verkliga åtskilt ägande beviljas extra tid för att tillämpa de relevantabestämmelserna.Medtankepådevertikalakopp­ lingarna mellan el- och gassektorn bör bestämmelserna om åtskillnad dessutom tillämpas tvärsöver båda sektorerna.

(12)Vid åtskilt ägande bör, för att säkerställa att nätdriften är helt oberoende av leverans- och produktionsintressen och förhindra utbyte av konfidentiella uppgifter, inte samma personsittaistyrelsenförbådeensystemansvarigföröver­ föringssystem eller ett överföringssystem och ett företag som bedriver produktions- eller leveransverksamhet. Av samma skäl bör samma person inte ha rätt att utse med­ lemmar till en styrelse för en systemansvarig för ett över­ föringssystem eller ett överföringssystem och inte heller utöva kontroll över eller rättigheter gentemot ett produk­ tionsföretag eller ett gashandelsföretag.

(13)Inrättandet av systemansvariga eller systemansvariga för överföringssystem vilka är oberoende av leverans- eller produktionsintressen bör göra det möjligt för vertikalt integrerade företag att bibehålla sitt ägande av nättill­ gångar, samtidigt som en effektiv intresseuppdelning

(1) EUT L 24, 29.1.2004, s. 1.

säkras, förutsatt att den oberoende systemansvarige (ISO) eller den oberoende systemansvarige för överföring (ITO) utför den systemansvariges samtliga uppgifter samt att detaljerad reglering och omfattande myndighetstillsyn införs.

(14)När ett företag som den 3 september 2009 äger ett över­ föringssystem ingår i ett vertikalt integrerat företag bör medlemsstaterna därför ges ett val mellan ägarskapsåtskild systemansvarig för överföringssystemet (TSO) och infö­ rande av oberoende systemansvariga eller oberoende sys­ temansvariga för överföring utan leverans- eller produktionsintressen.

(15)För att till fullo kunna tillvarata aktieägarnas intressen i vertikalt integrerade företag bör medlemsstaterna kunna välja mellan att antingen införa åtskilt ägande genom direkt avyttring eller genom att dela upp det integrerade företagets aktier på aktier i nätföretaget och aktier i det återstående leverans- och produktionsföretaget, förutsatt att kraven i samband med åtskilt ägande faktiskt har uppfyllts.

(16)För att införandet av en oberoende systemansvarig eller oberoende systemansvarig för överföring ska vara effektivt bör särskilda kompletterande regler antas. Reglerna för den oberoende systemansvarige för överföring ger ett lämpligt regelverkförattgaranterafungerandekonkurrens,tillräck­ liga investeringar, tillträde för nya aktörer på marknaden och integration av gasmarknaderna. Effektiv åtskillnad med hjälp av reglerna för den oberoende systemansvarige för överföring bör bygga på dels en pelare av organisato­ riska åtgärder och åtgärder avseende förvaltningen av sys­ temansvariga för överföring, dels en pelare av åtgärder avseendeinvesteringar,anslutningavnyproduktionskapa­ citet till nätet och marknadsintegrering genom regionalt samarbete. Oberoendet för den systemansvarige för över­ föring bör också bland annat säkerställas genom vissa ”avkylningsperioder”, under vilka ingen ledningsverksam­ het eller annan relevant verksamhet som ger tillgång till samma information som den som erhållits i en ledande ställning i ett företag utövas inom det vertikalt integrerade företaget. Modellen för effektiv åtskillnad med hjälp av en oberoende systemansvarig för överföring uppfyller de krav som fastställdes vid Europeiska rådets möte den 8 och

9 mars 2007.

(17)I syfte att utveckla konkurrensen på den inre marknaden för gas bör stora icke-hushållskunder ha möjlighet att välja gashandlare och teckna avtal med flera gashandlare för att täcka sina försörjningsbehov. Dessa kunder bör skyddas mot exklusivitetsklausuler, som utesluter konkurrerande eller kompletterande anbud.

106

Prop. 2011/12:77

Bilaga 2

L 211/96

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

(18)En medlemsstat har rätt att välja fullständigt åtskilt ägande på sitt territorium. Om en medlemsstat har valt fullstän­ digt åtskilt ägande, har ett företag inte rätt att välja alter­ nativet med en oberoende systemansvarig eller en oberoende systemansvarig för överföring. Företag som bedriver något slags produktions- eller leveransverksamhet får dessutom inte direkt eller indirekt utöva kontroll över ellernågonrättighetgentemotensystemansvarigföröver­ föringssystem från en medlemsstat som har valt fullstän­ digt åtskilt ägande.

(19)Det kommer enligt detta direktiv att finnas olika typer av marknadsorganisation på den inre marknaden för natur­ gas. De åtgärder som medlemsstaterna kan vidta för att säkerställa lika villkor på marknaden bör grunda sig på överordnade krav av allmänt intresse. Samråd bör ske med kommissionen om åtgärdernas förenlighet med fördraget och gemenskapslagstiftningen.

(20)När en effektiv åtskillnad genomförs, bör principen om icke-diskriminering mellan den offentliga och den privata sektorn respekteras. Därför bör samma person, på egen hand eller tillsammans med någon annan, inte tillåtas att, i strid med det åtskilda ägandet eller med lösningen med en oberoende systemansvarig, utöva kontroll över eller någon rättighet i fråga om sammansättning av och röstning eller beslutsfattande i både organ för systemansvariga för över­ föringssystem eller överföringssystem och organ för produktionsföretag eller gashandelsföretag. Under förut­ sättning att medlemsstaten i fråga kan visa att detta krav uppfylls,börvidåtskiltägandeochlösningenmedenobe­ roende systemansvarig två skilda offentliga organ kunna kontrollera produktion och leverans å ena sidan och över­ föring å den andra.

(21)Effektiv åtskillnad mellan å ena sidan nätverksamhet och å andra sidan leverans och produktion bör gälla i hela gemenskapen, för både gemenskapsföretag och icke- gemenskapsföretag. För att säkerställa att å ena sidan nät­ verksamheten och å andra sidan leverans och produktion i gemenskapen bedrivs oberoende av varandra, bör tillsyns­ myndigheterna ges befogenheter att vägra certifiering av sådana systemansvariga för överföringssystem som inte uppfyller bestämmelserna om åtskillnad. För att säkerställa attdessabestämmelsertillämpasenhetligtihelagemenska­ pen bör tillsynsmyndigheterna ta största möjliga hänsyn till kommissionens uppfattning, när de fattar beslut om certifiering. För att dessutom säkerställa att gemenskapens internationella åtaganden respekteras, liksom solidariteten och försörjningstryggheten inom gemenskapen, bör kom­ missionenharättattavgeettyttrandeomcertifieringavse­ ende ägaren till eller den systemansvarige för ett

överföringssystemsomkontrollerasavenellerfleraperso­ ner från tredjeländer.

(22)En tryggad energiförsörjning är absolut nödvändig för den allmänna säkerheten och är därför till sin natur förknippad med en effektivt fungerande inre marknad för gas och med en integration av medlemsstaternas separata gasmarkna­ der. Gasförsörjningen till unionens medborgare kan enbart ske genom ett nät. Fungerande öppna gasmarknader, och framför allt de nät och andra tillgångar som är förknippade med gasförsörjningen, har en avgörande betydelse för den allmänna säkerheten, ekonomins konkurrenskraft och för unionsmedborgarnas välfärd. Personer från tredjeländer bör därför endast tillåtas kontrollera ett överföringssystem ellerensystemansvarigföröverföringssystem, omdeupp­ fyller de krav på effektiv åtskillnad som tillämpas inom gemenskapen. Utan att det påverkar gemenskapens inter­ nationella åtaganden anser gemenskapen att sektorn för

överföringssystem för gas är mycket viktig för gemenska­ pen och att ytterligare skyddsåtgärder därför behövs när det gäller att upprätthålla en tryggad energiförsörjning till gemenskapen i syfte att förhindra hot mot den allmänna ordningen och den allmänna säkerheten i gemenskapen och unionsmedborgarnas välfärd. En trygg energiförsörj­ ning till gemenskapen kräver i synnerhet en bedömning av nätdriftens oberoende, nivån på gemenskapens och enskilda medlemsstaters beroende av energiförsörjning från tredjeländer samt av hur både inhemsk och interna­ tionell handel och energiinvesteringar hanteras i ett visst tredjeland. Försörjningstryggheten bör därför bedömas mot bakgrund av de faktiska omständigheterna i varje enskilt fall samt de rättigheter och skyldigheter som upp­ kommer enligt internationell rätt, särskilt de internationella avtalen mellan gemenskapen och det berörda tredjelandet.

Kommissionenuppmanasattvidbehovläggaframrekom­ mendationer för förhandlingar om relevanta avtal med tredjeländer beträffande en trygg energiförsörjning till gemenskapen, eller ta med de nödvändiga frågorna i andra förhandlingar med dessa tredjeländer.

(23)Det behövs ytterligare åtgärder för att säkerställa transpa­ renta och icke-diskriminerande tariffer för tillträde till transport. Tarifferna bör gälla alla användare av systemen, utan diskriminering. När lagringsanläggningar, lagring av gas i rörledningar eller stödtjänster opererar på en tillräck­ ligt konkurrensutsatt marknad kan tillträde medges på grundval av transparenta och icke-diskriminerande mark­ nadsbaserade mekanismer.

(24)Det är nödvändigt att se till att systemansvariga för lag­ ringssystemen är oberoende i syfte att förbättra tredje parts tillträde till lagringsanläggningar när detta är tekniskt och/ellerekonomisktnödvändigtförattdeskakunnaleve­ rera till kunderna på ett effektivt sätt. Det är därför lämp­ ligt att lagringsanläggningar drivs genom juridiskt skilda enheter som har faktisk rätt att fatta beslut när det gäller de tillgångar som behövs för att underhålla, driva och utveckla lagringsanläggningarna. Det är också nödvändigt att öka transparensen när det gäller lagringskapacitet som erbjuds tredje part genom att förpliktiga medlemsstaterna att

107

Prop. 2011/12:77

Bilaga 2

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/97

 

 

 

 

fastställa och offentliggöra en icke-diskriminerande och tydlig ram som omfattar lämpliga tillsynsformer för lag­ ringsanläggningar. Denna förpliktelse bör inte kräva ett nytt beslut beträffande reglerna om tillträde, men bör leda till förbättrad transparens när det gäller reglerna om till­ träde till lagring. Kravet på konfidentialitet för kommersi­ ellt känslig information är särskilt viktigt när det gäller uppgifter av strategisk karaktär eller när det finns endast en enda användare av en lagringsanläggning.

(25)Icke-diskriminerande tillträde till distributionsnätet är avgörande för tillträdet för kunder i återförsäljarledet.

Utrymmetfördiskrimineringnärdetgällertredjepartstill­ träde och investeringar är dock mindre på distributions­ nivå än på överföringsnivå, eftersom nätbegränsningar och produktionsintressenas inflytande i allmänhet inte är så betydande på distributionsnivån som på överföringsnivån.

I enlighet meddirektiv 2003/55/EG blev rättsligochfunk­ tionell åtskillnad av systemansvariga för distributionssys­ temet dessutom obligatorisk först från och med den 1 juli

2007 och dess effekter på den inre marknaden för natur­ gas har ännu inte utvärderats. De regler om rättslig och funktionell åtskillnad som för närvarande finns kan leda till effektiv åtskillnad förutsatt att de definieras tydligare, genomförs ordentligt och övervakas noggrant. För att skapa lika villkor i återförsäljarledet bör systemansvariga för distributionssystem övervakas, så att de hindras från att dra fördel av sin vertikala integration när det gäller kon­ kurrensläget på marknaden, framför allt gentemot hus­ hållskunder och små icke-hushållskunder.

(26)Medlemsstaterna bör vidta konkreta åtgärder för att främja ökad användning av biogas och gas från biomassa, och producenteravsådangasbörgesicke-diskriminerandetill­ träde till gassystemet, förutsatt att detta tillträde är fören­ ligt med de kontinuerligt relevanta tekniska föreskrifterna och säkerhetsstandarderna.

(27)För att undvika att små systemansvariga för distributions­ systemfårenoproportionerligekonomiskochadministra­ tiv börda bör medlemsstaterna vid behov kunna undanta berörda företag från krav på rättslig åtskillnad när det gäl­ ler distributionen.

(28)När ett slutet distributionssystem används för att trygga optimal effektivitet i en integrerad energiförsörjning som kräver särskilda driftsnormer, eller när ett slutet distribu­ tionssystem upprätthålls i första hand för att användas av systemets ägare, bör det vara möjligt att undanta den sys­ temansvarige för distributionssystemet från skyldigheter som skulle utgöra en onödig administrativ börda på grund av det särskilda förhållandet mellan den systemansvarige

för distributionssystemet och systemets användare. Indu­ striella och kommersiella platser samt platser där gemen­ samma tjänster tillhandahålls, såsom tågstationer, flygplatser, sjukhus, stora campingplatser med integrerade anläggningarellerkemiskaindustrianläggningar,kaninbe­ gripa slutna distributionssystem på grund av att den verk­ samhet som bedrivs i dessa anläggningar är av specialiserad karaktär.

(29)Genom direktiv 2003/55/EG infördes ett krav på med­ lemsstaterna att utse tillsynsmyndigheter med särskilda befogenheter.Erfarenheternavisardockatttillsynenseffek­ tivitetoftahämmasavatttillsynsmyndigheternainteärtill­ räckligt självständiga gentemot staten, har otillräckliga befogenheter och för liten handlingsfrihet. Därför uppma­ nade Europeiska rådet vid sitt möte den 8-9 mars 2007 kommissionen att utarbeta lagstiftningsförslag för ytterli­ gare harmonisering av medlemsstaternas energitillsyns­ myndigheters befogenheter och förstärkning av deras oberoende. Det bör vara möjligt för dessa nationella till­ synsmyndigheter att omfatta både el- och gassektorn.

(30)För att den inre marknaden för naturgas ska kunna fung­ era korrekt behöver energitillsynsmyndigheterna kunna fatta beslut i alla relevanta tillsynsfrågor, och de måste också vara fullständigt oberoende av övriga offentliga eller privata intressen. Detta hindrar inte domstolsprövning och parlamentarisk övervakning enligt medlemsstaternas kon­ stitutionella rätt. Vidare får inte den nationella lagstiftarens godkännande av tillsynsmyndigheternas budget utgöra ett hinder för budgetmässig självständighet. Reglerna om till­ synsmyndighetens självständiga ansvar för genomförandet av den anslagna budgeten bör tillämpas inom ramen för nationell budgetlagstiftning och nationella budgetbestäm­ melser. Samtidigt som medlemsstaterna med hjälp av ett lämpligtroterandesystembidrartilldennationellatillsyns­ myndighetens oberoende gentemot politiska eller ekono­ miska intressen, bör medlemsstaterna ha möjlighet att vederbörligen beakta de tillgängliga personella resurserna och styrelsens storlek.

(31)Förattsäkerställaeffektivtmarknadstillträdeförallamark­ nadsaktörer, inklusive nya aktörer, krävs icke- diskriminerande balansmekanismer som avspeglar kostnaderna. Detta bör uppnås genom att man inför sådana transparenta marknadsbaserade mekanismer för försörjning och inköp av gas som krävs för att uppfylla kraven på balans. De nationella tillsynsmyndigheterna bör arbeta aktivt för att balanstarifferna ska vara icke- diskriminerande och avspegla kostnaderna. Samtidigt bör lämpliga incitament tillhandahållas för att balansera pro­ duktion och förbrukning av gas och för att inte äventyra systemet.

108

Prop. 2011/12:77

Bilaga 2

L 211/98

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

(32)De nationella tillsynsmyndigheterna bör kunna fastställa eller godkänna tariffer eller beräkningsmetoder för tariffer på grundval av ett förslag från den systemansvarige för överförings- eller distributionssystemet eller LNG- anläggningar eller på grundval av ett förslag som en syste­ mansvarig och nätanvändarna kommit överens om. Vid fastställandet eller godkännandet bör tillsynsmyndigheten se till att överförings- eller distributionstarifferna är icke- diskriminerande och avspeglar kostnaderna och samtidigt ta hänsyn till de långsiktiga marginalkostnader för näten som går att undvika med hjälp av åtgärder för styrning av efterfrågan.

(33)Energitillsynsmyndigheterna bör ha befogenhet att fatta bindande beslut avseende naturgasföretag och antingen själva besluta, eller föreslå att en behörig domstol beslutar, om effektiva, proportionerliga och avskräckande sanktio­ ner för naturgasföretag som inte fullgör sina skyldigheter. Energitillsynsmyndigheterna bör även ges befogenhet att, oavsett tillämpningen av konkurrensbestämmelserna, fatta beslut om åtgärder som säkerställer fördelar för kunderna genomfrämjandeavdeneffektivakonkurrenssomärnöd­ vändig för att den inre marknaden för naturgas ska fung­ era korrekt. Program för frigörande av gas är en av möjliga åtgärder för att främja effektiv konkurrens och säkerställa att marknaden fungerar korrekt. Energitillsynsmyndighe­ terna bör även ges befogenheter att bidra till att säkerställa en hög standard på allmännyttiga tjänster som står i sam­ klang med kraven på öppnande av marknaden, skydd för utsatta kunder och ett verkligt effektivt konsumentskydd. Dessa bestämmelser bör varken påverka kommissionens befogenheter att tillämpa konkurrensreglerna, inbegripet granskningen av företagskoncentration med en gemen­ skapsdimension, eller reglerna för den inre marknaden, såsom den fria rörligheten för kapital. Det oberoende organ till vilket en part som berörs av ett beslut av en nationell tillsynsmyndighet har rätt att överklaga kan vara en domstol eller annan rättslig instans med befogenhet att genomföra en rättslig prövning.

(34)Harmonisering av de nationella tillsynsmyndigheternas befogenheterbörinbegripabefogenheteratterbjudanatur­ gasföretagen incitament och befogenheter att fastställa effektiva, proportionerliga och avskräckande sanktioner för dessa företag eller att föreslå en behörig domstol att besluta om sådana sanktioner. Dessutom bör tillsynsmyn­ digheterna ha befogenhet att begära in relevant informa­ tion från naturgasföretagen, göra lämpliga och tillräckliga undersökningar samt lösa tvister.

(35)Investeringar i viktig ny infrastruktur bör kraftigt priorite­ ras, samtidigt som man ser till att den inre marknaden för naturgas fungerar korrekt. För att förstärka de positiva effekterna på konkurrens och försörjningstrygghet

av undantagna infrastrukturprojekt bör det göras en pröv­ ning av marknadens intresse i projektets planeringsfas, och samtidigtbörbestämmelsernaförhanteringavöverbelast­ ning tillämpas. Om ett infrastrukturprojekt sträcker sig över mer än en medlemsstats territorium bör byrån för samarbete mellan energitillsynsmyndigheter, inrättad genom Europaparlamentets och rådets förordning (EG) nr713/2009avden13juli2009om inrättande av en byrå för samarbete mellan energitillsynsmyndigheter (1) (nedan kallad byrån), i sista hand behandla ansökan om undantag i syfte att bättre beakta dess gränsöverskridande följder och underlätta administrationen. Med anledning av den excep­ tionella riskprofil som kännetecknar genomförandet av de undantagna större infrastrukturprojekten, bör det också vara möjligt att tillfälligt bevilja företag med leverantörs- och produktionsintressen partiella undantag från bestäm­ melserna om åtskillnad för projekten i fråga. Med tanke på försörjningstryggheten bör möjligheten till tillfälliga undantag särskilt gälla nya rörledningar inom gemenska­ pen som transporterar gas från tredjeländer till gemenska­ pen. Undantag som beviljas i enlighet med direktiv 2003/55/EGfortsätterattgällaframtilldetplaneradeslut­ datum som fastställs i beslutet om beviljande av undantag.

(36)Den inre marknaden för naturgas har vissa brister när det gäller likviditet och transparens, vilket hindrar effektiv resursfördelning, riskgardering och etablering av nya före­ tag på marknaden. Förtroendet för marknaden, dess likvi­ ditet och antalet marknadsaktörer måste öka, och därför måste tillsynen av företag verksamma på området för gas­ försörjning stärkas. Sådana krav bör inte påverka, och bör vara förenliga med, befintlig gemenskapslagstiftning beträffandefinansmarknaderna.Tillsynsmyndigheternaför energisektorn och för finansmarknaden behöver samarbeta för att göra det möjligt för varandra att få en överblick över berörda marknader.

(37)Tillövervägandedel,ochistigandegrad,importerasnatur­ gas till gemenskapen från tredjeländer. Gemenskapslag­ stiftningen bör ta hänsyn till naturgassektorns särdrag, exempelvis en viss strukturell stelhet som har sin grund i koncentrationenavgashandlare,långsiktigaavtalochbris­ ten på likviditet i slutkundsledet. Därför krävs ökad trans­ parens, bland annat i fråga om prisbildning.

(38)Innankommissionenantarriktlinjerförkravennärdetgäl­ ler bevarande av information, bör byrån och Europeiska värdepapperstillsynskommittén (EVTK), inrättad genom

(1) Se sidan 1 i detta nummer av EUT.

109

Prop. 2011/12:77

Bilaga 2

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/99

 

 

 

 

kommissionens beslut 2009/77/EG (1), samråda och råda kommissionen om innehållet i dessa riktlinjer. Byrån och EVTKbörocksåsamarbetaförattytterligareutredaochge rådifråganomhuruvidatransaktionermedavtalomleve­ ransavgasochgasderivatböromfattasavtransparenskrav före och/eller efter handel och i så fall hur dessa krav bör utformas.

(39)Medlemsstaterna eller, om en medlemsstat föreskrivit detta,tillsynsmyndighetenböruppmuntrautvecklingenav avbrytbara leveransavtal.

(40)Av försörjningstrygghetsskäl bör balansen mellan tillgång ochefterfråganpågasivarjeenskildmedlemsstatbevakas, varefter en rapport bör utarbetas om situationen i gemen­ skapen som helhet med hänsyn till sammanlänkningska­ paciteten mellan områden. Denna övervakning bör göras i tillräckligt god tid, så att lämpliga åtgärder hinner vidtas om försörjningstryggheten äventyras. Det faktum att nöd­ vändig nätinfrastruktur, bland annat sammanlänkningska­ paciteten, anläggs och underhålls bör bidra till en stabil gasförsörjning.

(41)Medlemsstaterna bör, med beaktande av nödvändiga kva­ litetskriterier, se till att biogas och gas från biomassa eller andra typer av gas kan få icke-diskriminerande tillträde till systemet under förutsättning att detta tillträde är perma­ nent förenligt med relevanta tekniska bestämmelser och säkerhetsstandarder. Dessa bestämmelser och standarder bör säkerställa att det är tekniskt möjligt att på ett säkert sätt föra in dessa gaser i och transportera dem genom sys­ temet för naturgas och bör även omfatta deras kemiska egenskaper.

(42)Medlemsstaterna kommer också i fortsättningen att behövalångsiktigaavtalförsingasförsörjning,ochgashan­ delsföretagen bör kunna fortsätta att använda sådana avtal så länge de inte motverkar målsättningen med detta direk­ tiv och så länge de är förenliga med fördraget och dess konkurrensregler. Det är därför nödvändigt att ta hänsyn till långsiktiga avtal vid planering av naturgasföretagens leverans- och transportkapacitet.

(43)För att säkerställa att de allmännyttiga tjänsterna i gemen­ skapen håller hög kvalitet bör medlemsstaterna regelbun­ det underrätta kommissionen om alla åtgärder som vidtagits för att uppnå målet med detta direktiv. Kommis­ sionenbörregelbundetoffentliggöraenrapportsominne­ håller en analys av de nationella åtgärder som vidtagits för att uppnå målsättningarna när det gäller allmännyttiga tjänster samt en jämförelse av åtgärdernas effektivitet, i syfte att utfärda rekommendationer om vilka nationella åtgärder som bör vidtas för att de allmännyttiga tjänsterna

(1) EUT L 25, 29.1.2009, s. 18.

skahållahögkvalitet.Medlemsstaternabörocksåsetillatt kunderna, när de är anslutna till gassystemet, informeras om sin rätt att få tillgång till gasförsörjning av en bestämd kvalitettillrimligapriser.Åtgärdersomvidtasavmedlems­ staternaförattskyddaslutkonsumenten kan varaolikaför hushållskunder och för små och medelstora företag.

(44)Respekt för kraven när det gäller allmännyttiga tjänster är ettgrundläggandekravidettadirektiv,ochdetärviktigtatt det i direktivet anges gemensamma minimikrav som upp­ fyllsavsamtligamedlemsstaterochsombeaktarmålenom konsumentskydd, försörjningstrygghet, miljöskydd samt likvärdiga konkurrensnivåer i samtliga medlemsstater. Det är viktigt att kraven när det gäller allmännyttiga tjänster kan tolkas på nationell grund, med beaktande av natio­ nella omständigheter om inte annat följer av gemenskapslagstiftningen.

(45)De åtgärder som medlemsstaterna vidtar för att uppnå målen när det gäller social och ekonomisk sammanhåll­ ning bör bland annat kunna innefatta lämpliga ekono­ miska stimulansåtgärder, där så är lämpligt med hjälp av allatillgängliganationellaverktygochgemenskapsverktyg. Dessa verktyg kan innefatta ansvarsmekanismer för att säkerställa nödvändiga investeringar.

(46)Om de åtgärder som medlemsstaterna vidtar för att full­ göra skyldigheten att tillhandahålla allmännyttiga tjänster kan definieras som statligt stöd enligt artikel 87.1 i fördra­ get är medlemsstaterna enligt artikel 88.3 i fördraget skyl­ diga att underrätta kommissionen om detta.

(47)Kravennärdetgällerallmännyttigatjänsterochdegemen­ samma miniminormer som är en följd av dem måste stär­ kas ytterligare för att alla kunder, särskilt utsatta kunder, skakunnagynnasavkonkurrensenochskäligapriser.Kra­ ven på allmännyttiga tjänster bör definieras på nationell nivå och med hänsyn till nationella omständigheter; gemenskapslagstiftningen bör emellertid respekteras av medlemsstaterna. Unionsmedborgarna och, när medlems­ staterna finner det lämpligt, småföretagen, bör garanteras allmännyttiga tjänster, i synnerhet försörjningstrygghet och rimliga tariffer. En viktig aspekt när det gäller leverans till konsumenterna är tillgången till objektiva och transpa­ renta förbrukningsuppgifter. Konsumenterna bör således ha tillgång till sina förbrukningsuppgifter och tillhörande priser och servicekostnader så att de kan begära in offerter från konkurrenter på grundval av dessa uppgifter. Konsu­ menterna bör även ha rätt att få ordentlig information om sin energianvändning. Förskottsbetalningarna bör åter­ spegla den sannolika naturgasförbrukningen och de olika betalningssystemen bör vara icke-diskriminerande. Om konsumenterna tillräckligt ofta ges information om ener­ gikostnaderna kommer de att uppmuntras till att spara energi, eftersom konsumenterna direkt ser effekterna av investeringar i energieffektivitet och ändrat beteende.

110

Prop. 2011/12:77

Bilaga 2

L 211/100

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

(48)Konsumenternas intressebör ståicentrum fördettadirek­ tiv och tjänsternas kvalitet bör höra till naturgasföretagens centrala ansvarsområden. Befintliga konsumenträttigheter behöver stärkas och tryggas och bör innefatta ökad trans­ parens. Konsumentskyddet bör säkerställa att alla konsu­ menter inom gemenskapens utökade ansvarsområde kan dra nytta av en konkurrensutsatt marknad. Medlemssta­ terna eller, om en medlemsstat föreskrivit detta, tillsyns­ myndigheterna, bör se till att konsumenträttigheterna tillgodoses.

(49)Konsumenterna bör få tydlig och begriplig information om sinarättigheteriförhållandetillenergisektorn.Kommissio­ nen bör, efter samråd med berörda intressenter, bland annat medlemsstaterna, de nationella tillsynsmyndighe­ terna, konsumentorganisationer och naturgasföretag, fast­ ställa en lättillgänglig och användarvänlig kontrollista för energianvändare,därkonsumenternafårpraktiskaupplys­ ningar om sina rättigheter. Denna kontrollista bör tillhan­ dahållas alla konsumenter och göras tillgänglig för allmänheten.

(50)Energifattigdom är ett växande problem i gemenskapen. De medlemsstater som berörs bör därför, om de ännu inte gjort det, utarbeta nationella handlingsplaner eller andra lämpliga ramar för att åtgärda energifattigdomen, varvid syftet bör vara att minska antalet människor som befinner sig i en sådan situation. Under alla omständigheter bör medlemsstaterna säkra nödvändig energiförsörjning för utsatta kunder. En integrerad metod skulle kunna använ­ das, till exempel inom socialpolitiken, och åtgärderna skulle kunna vara socialpolitiska eller inrikta sig på bättre energieffektivitet i bostäder. Detta direktiv bör åtminstone medge en nationell politik till förmån för utsatta kunder.

(51)Effektiva tvistlösningsmöjligheter för alla konsumenter borgar för ett bättre konsumentskydd. Medlemsstaterna bör införa snabba och effektiva förfaranden för behandling av klagomål.

(52)Det bör vara möjligt att basera införandet av system med smarta mätare på en ekonomisk bedömning. Om det vid en sådan bedömning skulle framgå att det endast är eko­ nomiskt rimligt och kostnadseffektivt med sådana mätare för konsumenter med en viss gasförbrukning bör med­ lemsstaterna ha möjlighet att ta hänsyn till detta när de bygger ut systemen med smarta mätare.

(53)Marknadspriserna bör ge de rätta incitamenten för utveck­ lingen av nätet.

(54)Det bör vara av största vikt för medlemsstaterna att verka för fungerande konkurrens och att olika gashandlare utan svårighet får tillträde till marknaden, för att konsumen­ terna ska kunna dra full fördel av en liberaliserad inre marknad för naturgas.

(55)För att kunna bidra till försörjningstryggheten i solidarisk anda mellan medlemsstaterna, särskilt i händelse av en kris i energiförsörjningen, är det viktigt att tillhandahålla en ram för regionalt, solidariskt samarbete. Detta samarbete får, om medlemsstaterna beslutar så, främst förlita sig på marknadsbaserade mekanismer. Samarbete för främjande av regional och bilateral solidaritet får inte innebära en oproportionerlig börda för eller leda till diskriminering mellan marknadsaktörerna.

(56)Medlemsstaterna bör inför inrättandet av en inre marknad för naturgas främja integrationen av sina inhemska mark­ nader och samarbetet mellan systemoperatörer på gemen­ skapsnivå och regional nivå, vilket också bör omfatta de isolerade system som bildar så kallade gasöar, som fortfa­ rande existerar i gemenskapen.

(57)Ett viktigt mål för detta direktiv bör vara att med hjälp av ett sammanlänkat nät över hela gemenskapen utveckla en verklig inre marknad för naturgas, och tillsynsmyndighe­ terna bör därför ha som en av sina huvuduppgifter att, i förekommandefallinärasamarbetemedbyrån,skötareg­ leringen av gränsöverskridande sammanlänkningar och regionala marknader.

(58)Ett annat viktigt mål för detta direktiv bör vara att säker­ ställa gemensamma bestämmelser för en verklig inre marknad för gas och ett brett gasutbud. Korrekta mark­ nadspriser skulle i detta syfte ge ett incitament till gränsö­ verskridande sammanlänkningar, samtidigt som det på lång sikt skulle leda till priskonvergens.

(59)Tillsynsmyndigheterna bör också tillhandahålla informa­ tion om marknaden så att kommissionen kan utöva sin roll som observatör och övervakare av den inre markna­ den för naturgas och dess utveckling på kort, medellång och lång sikt, inklusive aspekter som tillgång och efterfrå­ gan, infrastruktur för överföring och distribution, tjänster­ nas kvalitet, gränsöverskridande handel, hantering av

överbelastning, investeringar, grossist- och konsumentpri­ ser, marknadens likviditet samt miljö- och effektivitetsför­ bättringar. De nationella tillsynsmyndigheterna bör underrätta konkurrensmyndigheterna och kommissionen om medlemsstater där priserna utgör ett hinder för kon­ kurrensen och en väl fungerande marknad.

111

Prop. 2011/12:77

Bilaga 2

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/101

 

 

 

 

(60)Eftersom målet för detta direktiv, nämligen att skapa en fullständigt fungerande inre marknad för naturgas, inte i tillräcklig utsträckning kan uppnås av medlemsstaterna och det därför bättre kan uppnås på gemenskapsnivå, kan gemenskapen vidta åtgärder i enlighet med subsidiaritets­ principen i artikel 5 i fördraget. I enlighet med proportio­ nalitetsprincipen i samma artikel går detta direktiv inte utöver vad som är nödvändigt för att uppnå detta mål.

(61)Enligt Europaparlamentets och rådets förordning (EG) nr 715/2009 av den 13 juli 2009 om villkor för tillträde till naturgasöverföringsnäten (1) kan kommissionen anta riktlinjer i syfte att uppnå den harmoniseringsgrad som krävs. Sådana riktlinjer, som utgör bindande genomföran­ deåtgärder, är, även med avseende på vissa bestämmelser i detta direktiv, ett användbart hjälpmedel som snabbt kan ändras om det skulle behövas.

HÄRIGENOM FÖRESKRIVS FÖLJANDE.

KAPITEL I

SYFTE, TILLÄMPNINGSOMRÅDE OCH DEFINITIONER

Artikel 1

Syfte och tillämpningsområde

1.Idettadirektivfastställsgemensammareglerföröverföring, distribution, leverans och lagring av naturgas. Det innehåller reg­ ler om naturgassektorns organisation och funktion, tillträde till marknaden och de kriterier och förfaranden som ska tillämpas vid beviljande av tillstånd för överföring, distribution, leverans och lagring av naturgas samt drift av system.

2.De bestämmelser som fastställs i detta direktiv för naturgas,

(62)De åtgärder som är nödvändiga för att genomföra detta inbegripet kondenserad naturgas (LNG), ska även på ett icke-

direktiv bör antas i enlighet med rådets beslut

1999/468/EGavden28juni1999om de förfaranden som skall tillämpas vid utövandet av kommissionens genomförandebefogenheter (2).

diskriminerande sätt gälla biogas och gas från biomassa eller andra typer av gas om det är tekniskt möjligt och säkert att föra in dessa gaser i och transportera dem genom naturgassystemet.

Artikel 2

(63)Kommissionen bör särskilt ges befogenhet att anta de rikt­ linjer som krävs för att den grad av harmonisering ska kunna åstadkommas som behövs för att syftet med detta direktiv ska kunna uppnås. Eftersom dessa åtgärder har en allmän räckvidd och avser att ändra icke väsentliga delar av detta direktiv genom att komplettera det med nya icke väsentligadelar,måstedeantasienlighetmeddetföreskri­ vande förfarandet med kontroll i artikel 5a i beslut 1999/468/EG.

(64)Ienlighetmedpunkt34idetinterinstitutionellaavtaletom bättre lagstiftning (3) uppmuntras medlemsstaterna att för egen del och i gemenskapens intresse upprätta egna tabel­ lersomsåvittdetärmöjligtvisaröverensstämmelsenmel­ lan detta direktiv och införlivandeåtgärderna samt att offentliggöra dessa tabeller.

Definitioner

I detta direktiv avses med

1.naturgasföretag: varje fysisk eller juridisk person, med undan­ tag för slutförbrukare, som bedriver åtminstone en av föl­ jande verksamheter: produktion, överföring, distribution, leverans, köp eller lagring av naturgas, inbegripet LNG, som ansvarar för kommersiella och tekniska arbetsuppgifter och/eller underhåll i samband med dessa verksamheter.

2.tidigare led i rörledningsnätet: varje rörledning eller nät av rör­ ledningarsomdrivsoch/ellerbyggssomendelavenanlägg­ ning för olje- eller gasproduktion, eller som används för att

överföra naturgas från en eller flera sådana anläggningar till en bearbetningsanläggning eller terminal eller slutlig land­ ningsterminal vid kusten.

(65)Med tanke på omfattningen av ändringarna av direktiv

2003/55/EG är det av tydlighets- och rationaliseringsskäl

önskvärt att det görs en omarbetning av bestämmelserna i fråga till en enda text i ett nytt direktiv.

(66)Detta direktiv står i överensstämmelse med de grundläg­ gande rättigheter och principer som erkänns särskilt i Europeiska unionens stadga om de grundläggande rättigheterna.

(1) Se sidan 36 i detta nummer av EUT. (2) EGT L 184, 17.7.1999, s. 23.

(3) EUT C 321, 31.12.2003, s. 1.

3.överföring: transport, vars avsikt är tillhandahållande till kun­ der, men inte leverans, av naturgas genom ett nät som i huvudsak består av högtrycksrörledningar, undantaget tidi­ gare led i rörledningsnätet och undantaget den del av hög­ trycksrörledningarna som huvudsakligen används för lokal distribution av naturgas.

4.systemansvarig för överföringssystemet: varje fysisk eller juridisk person som bedriver överföringsverksamhet och som ansva­ rarfördriftochunderhålloch,vidbehov,utbyggnadavöver­ föringssystemet inom ett visst område och, i tillämpliga fall, dess sammanlänkningar till andra system och för att säker­ ställa att systemet på lång sikt kan uppfylla rimliga krav på gastransporter.

112

Prop. 2011/12:77

Bilaga 2

L 211/102

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

5.distribution: transport av naturgas genom lokala eller regio­ nala rörledningsnät för tillhandahållande till kunder, men inte leverans.

6.systemansvarig för distributionssystemet: varje fysisk eller juridisk person som bedriver distributionsverksamhet och som ansvarar för drift och underhåll och, vid behov, utbyggnad av distributionssystemet inom ett visst område och, i tillämpliga fall, dess sammanlänkningar till andra system och för att säkerställa att systemet på lång sikt kan uppfylla rimliga krav på gasdistribution.

7.leverans eller handel: försäljning, inbegripet återförsäljning, av naturgas, inbegripet LNG, till kunder.

8.gashandelsföretag eller gashandlare: varje fysisk eller juridisk person som bedriver leveransverksamhet.

9.lagringsanläggning: en anläggning som används för lagring av naturgas och som ägs och/eller drivs av ett naturgasföretag, inbegripet den del av en LNG-anläggning som används för lagring men undantaget den del som används för produk­ tionsverksamhet, och undantaget anläggningar som uteslu­ tande är förbehållna systemansvariga för överföringssystemet när de utför sina uppgifter.

10.systemansvarig för lagringssystemet: varje fysisk eller juridisk person som bedriver lagringsverksamhet och som ansvarar för driften av en lagringsanläggning.

11.LNG-anläggning: en terminal som används för kondensering av naturgas eller import, lossning och återförgasning av LNG, inklusive stödtjänster och den tillfälliga lagring som krävs för

återförgasningsprocessen och efterföljande leverans till över­ föringssystemet, men undantaget den del av en LNG- anläggning som används för lagring.

12.systemansvarig för en LNG-anläggning: varje fysisk eller juridisk person som ägnar sig åt kondensering av naturgas eller import, lossning och återförgasning av LNG och som ansva­ rar för driften av en LNG anläggning.

13.system: varje överföringsnät, distributionsnät, LNG- anläggning och/eller lagringsanläggning som ägs och/eller drivs av ett naturgasföretag, inbegripet lagring av gas i rör­ ledning och dess anläggningar för stödtjänster och sådana som tillhör anknutna företag och som är nödvändiga för att erbjuda tillgång till överföring, distribution och LNG.

14.stödtjänster: de tjänster som är nödvändiga för tillträdet till och driften av överförings- eller distributionsnät eller LNG- anläggningaroch/ellerlagringsanläggningar,inklusivelastba­ lans, blandning och injektion av inerta gaser men undantaget anläggningar som uteslutande är förbehållna systemansvariga för överföringssystemet när de utför sina uppgifter.

15.lagring av gas i rörledning: lagring av gas genom kompression i överförings- och distributionssystem för gas, men undanta­ get anläggningar som är förbehållna systemansvariga för överföringssystemet när de utför sina uppgifter.

16.sammanlänkat system: ett antal system som har länkats samman.

17.sammanlänkning: en överföringsledning som passerar eller sträcker sig över en gräns mellan två medlemsstater uteslu­ tande i syfte att koppla samman dessa medlemsstaters natio­ nella överföringssystem.

18.direktledning: en naturgasrörledning som kompletterar det sammanlänkade systemet.

19.integrerat naturgasföretag:ettvertikaltellerhorisontelltintegre­ rat företag.

20.vertikalt integrerat företag: ett naturgasföretag eller en grupp av naturgasföretag där samma person(er) direkt eller indirekt har rätt att utöva kontroll och där det berörda företaget eller den berörda företagsgruppen bedriver verksamhet inom minst ett av områdena överföring, distribution, LNG eller lagring och minst ett av områdena produktion eller leverans av naturgas.

21.horisontellt integrerat företag:ettföretagsombedriververksam­ hetinomminstettavområdenaproduktion,överföring,dist­ ribution, leverans eller lagring av naturgas samt en annan verksamhet utan anknytning till gas.

22.anknutet företag: ett anknutet företag enligt betydelsen i arti­ kel 41 i rådets sjunde direktiv 83/349/EEG av den 13 juni

1983 grundat på artikel 44.2 g (*) i fördraget om samman- ställd redovisning (1) och/eller intresseföretag enligt betydel- sen i artikel 33.1 i samma direktiv och/eller ett företag som tillhör samma aktieägare.

23.systemanvändare: varje fysisk eller juridisk person som levere­ rar till eller får leveranser från systemet.

24.kund: grossist eller slutförbrukare av naturgas samt naturgas­ företag som köper naturgas.

25.hushållskund: kund som köper naturgas för sin egen hushållsförbrukning.

26.icke-hushållskund: kund som köper naturgas som inte är avsedd för egen hushållsförbrukning.

27.slutförbrukare: kund som köper naturgas för eget bruk.

28.berättigad kund: kund som fritt kan välja gashandlare i den mening som avses i artikel 37.

(*) Titeln till direktiv 83/349/EEG har justerats med hänsyn till omnum­ reringen av artiklarna i fördraget om upprättandet av Europeiska gemenskapen, i enlighet med artikel 12 i Amsterdamfördraget. Ursprungligen hänvisades det till artikel 54.3 g.

(1) EGT L 193, 18.7.1983, s. 1.

113

Prop. 2011/12:77

Bilaga 2

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/103

 

 

 

 

29.grossist: varje fysisk eller juridisk person, med undantag för en systemansvarig för överförings- och distributionssystemet, som köper naturgas i syfte att återförsälja den inom eller utanför det system i vilket personen är etablerad.

30.långtidsplanering: naturgasföretags planering av leverans- och transportkapacitetpålångsiktförattkunnatillmötesgåefter­ frågan på naturgas i systemet, diversifiera källorna och säkra leveranserna till kunderna.

31.framväxande marknad: en medlemsstat i vilken den första kommersiella leveransen enligt det första långsiktiga avtalet för naturgasleveranser genomfördes för kortare tid än tio år sedan.

32.tillförlitlighet: både försörjningstrygghet i fråga om naturgas och teknisk säkerhet.

2. Medlemsstaterna får med beaktande fullt ut av tillämpliga bestämmelser i fördraget, särskilt artikel 86 i detta, för att tillgo­ dosedetallmännaekonomiskaintressetåläggaföretagsombedri­ ver verksamhet inom gassektorn att tillhandahålla allmännyttiga tjänster,vilkakanavsetillförlitlighet,inbegripetförsörjningstrygg­ het, leveransernas regelbundenhet, kvalitet och pris samt miljö­ skydd, inbegripet energieffektivitet, energi från förnybara energikällor och klimatskydd. Dessa åligganden ska vara klart definierade, transparenta, icke-diskriminerande och kontroller­ bara samt garantera att naturgasföretag i gemenskapen kan nå ut till nationella konsumenter på lika villkor. När det gäller försörj­ ningstrygghet, styrning av energieffektivitet och energiefterfrågan och för att uppfylla de miljömål och mål för energi från förny­ bara energikällor som avses i denna punkt får medlemsstaterna införa långtidsplanering, varvid hänsyn ska tas till att tredje part kan komma att ansöka om tillträde till systemet.

33.ny infrastruktur: en infrastruktur som inte färdigställts senast den 4 augusti 2003.

34.avtal om leverans av gas: ett avtal om leverans av naturgas, men som inte inbegriper ett gasderivat.

35.gasderivat: ett finansiellt instrument som anges i en av punk­ terna 5, 6 eller 7 i avsnitt C i bilaga I till Europaparlamentets och rådets direktiv 2004/39/EG av den 21 april 2004 om marknader för finansiella instrument (1), och som avser naturgas.

36.kontroll: rättigheter, avtal eller andra medel som, antingen var för sig eller tillsammans och med hänsyn till alla faktiska eller rättsliga förhållanden, ger möjlighet att utöva ett avgörande inflytande på ett företag, särskilt genom

a)äganderättellernyttjanderätttillettföretagssamtligatill­ gångar eller en del av dessa,

3. Medlemsstaterna ska vidta lämpliga åtgärder för att skydda slutförbrukare och de ska särskilt se till att utsatta kunder får till­ räckligt skydd. Varje medlemsstat ska härvidlag definiera begrep­ pet utsatta kunder, varvid det kan hänvisas till energifattigdom och bland annat föreskrivas förbud mot avstängning av dessa kunder från leverans av gas i kritiska situationer. Medlemsstaterna ska se till att rättigheter och skyldigheter för utsatta kunder res­ pekteras. De ska framför allt vidta lämpliga åtgärder för att skydda slutförbrukare i avlägsna områden som är anslutna till gassyste­ met. Medlemsstaterna får utse en sistahandsleverantör för kunder anslutnatillgasnätet.Deskasäkerställaenhögkonsumentskydds­ nivå,särskiltiformavtransparentaavtalsvillkor,allmäninforma­ tion och mekanismer för tvistlösning. Medlemsstaterna ska säkerställa att berättigade kunder i praktiken lätt kan byta till en ny gashandlare. Åtminstone när det gäller hushållskunder ska dessa åtgärder omfatta dem som anges i bilaga I.

b)rättigheter eller avtal som ger ett avgörande inflytande på sammansättningen av ett företags organ och dessas voteringar eller beslut.

KAPITEL II

ALLMÄNNA REGLER FÖR ORGANISATIONEN AV SEKTORN

Artikel 3

Skyldighet att tillhandahålla allmännyttiga tjänster och skyddet av kunderna

4. Medlemsstaterna ska vidta lämpliga åtgärder, såsom att utfärda nationella energihandlingsplaner, föreskriva om sociala förmåner för att utsatta kunder ska få den energiförsörjning de behöver eller stödja energieffektivitetsförbättringar för att åtgärda energifattigdom där sådan fastställts, också i samband med åtgär­ der mot fattigdom överlag. Sådana åtgärder ska inte hindra ett effektivt öppnande av marknaderna enligt vad som föreskrivs i artikel37ellerenvälfungerandemarknad,ochkommissionenska i förekommande fall underrättas i enlighet med punkt 11 i denna artikel. Kommissionen ska dock inte underrättas om åtgärder som vidtas inom ramen för det allmänna socialförsäkringssystemet.

1. Medlemsstaterna ska, utan att det påverkar tillämpningen av punkt 2, på grundval av sin institutionella organisation och med vederbörlighänsyntillsubsidiaritetsprincipen,setillattnaturgas­ företag drivs i enlighet med principerna i detta direktiv för att uppnåenkonkurrensutsatt,säkerochmiljömässigthållbarnatur­ gasmarknad, och de får inte göra någon diskriminerande åtskill­ nad mellan dessa företag när det gäller deras rättigheter eller skyldigheter.

(1) EUT L 145, 30.4.2004, s. 1.

5. Medlemsstaterna ska se till att alla kunder som är anslutna till gasnätet har rätt att få sin gasförsörjning tillhandahållen av en gashandlare, under förutsättning att denne samtycker, oberoende av vilken medlemsstat gashandlaren är registrerad i, så länge gas­ handlaren följer gällande handels- och balansregler och försörj­ ningen tryggas. Därför ska medlemsstaterna vidta alla åtgärder som är nödvändiga för att se till att administrativa förfaranden inteinnebärnågothinderförleveransföretagsomredanärregist­ rerade i en annan medlemsstat.

114

Prop. 2011/12:77

Bilaga 2

L 211/104

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

6.Medlemsstaterna ska säkerställa

a)att om en kund under iakttagande av de avtalsenliga villko­ ren önskar byta gashandlare, den eller de berörda operatö­ rerna genomför detta byte inom tre veckor, och

b)att kunderna har rätt att erhålla samtliga relevanta förbrukningsuppgifter.

Medlemsstaterna ska säkerställa att alla kunder garanteras de rät­ tigheter som avses i första stycket a och b på ett icke- diskriminerande sätt i fråga om kostnader, arbete och tidsåtgång.

7.Medlemsstaterna ska vidta lämpliga åtgärder för att uppnå målen för social och ekonomisk sammanhållning, miljöskydd, däribland även metoder för att bekämpa klimatförändringar, samt försörjningstrygghet. Dessa åtgärder kan särskilt omfatta lämpliga ekonomiska stimulansåtgärder, där så är lämpligt med hjälp av alla tillgängliga nationella verktyg och gemenskapsverktyg, för underhåll och anläggning av nödvändig nätinfrastruktur, inbegri­ pet sammanlänkningskapacitet.

8.För att främja energieffektiviteten ska medlemsstaterna eller, om en medlemsstat föreskrivit detta, tillsynsmyndigheten starkt rekommendera att naturgasföretagen optimerar gasförbruk­ ningen, till exempel genom att tillhandahålla energiförvaltning, utveckla innovativa former för prissättning eller införa system med smarta mätare eller intelligenta nät, om det är lämpligt.

9.Medlemsstaterna ska se till att det inrättas gemensamma kontaktpunkter där konsumenterna kan få tillgång till all nödvändig information om sina rättigheter, gällande lagstift­ ning och tvistlösningsmöjligheter i händelse av en tvist. Dessa kontaktpunkter kan vara en del av allmänna konsumentupplysningsställen.

Medlemsstaterna ska se till att det finns en oberoende mekanism, till exempel i form av en energiombudsman eller ett konsument­ organ, för att säkerställa effektiv behandling av klagomål och tvistlösning utanför domstol.

10. Medlemsstaterna får besluta att inte tillämpa bestämmel­ sernaiartikel4ifrågaomdistributionidenutsträckningsomtil­ lämpningen av dessa rättsligt eller i praktiken skulle hindra naturgasföretagen från att fullgöra de förpliktelser som ålagts dem idetallmännaekonomiskaintresset,ochidenmånsomhandelns utveckling inte påverkas i en sådan utsträckning att det skulle strida mot gemenskapens intressen. Gemenskapens intressen omfattar bland annat konkurrens när det gäller berättigade kun­ der i enlighet med detta direktiv och artikel 86 i fördraget.

åtgärdernas eventuella inverkan på nationell och internationell konkurrens, oavsett om åtgärderna kräver undantag från detta direktiv eller ej. De ska därefter vartannat år underrätta kommis­ sionen om eventuella ändringar av dessa åtgärder, oavsett om åtgärderna kräver undantag från direktivet eller ej.

12. Kommissionen ska, efter samråd med berörda intressen­ ter, däribland medlemsstaterna, de nationella tillsynsmyndighe­ terna, konsumentorganisationer och naturgasföretag, fastställa en klar och kortfattad kontrollista för energianvändare, med prak­ tiska upplysningar om energianvändarnas rättigheter. Medlems­ staterna ska se till att gashandlarna eller de systemansvariga för distributionssystemet i samarbete med tillsynsmyndigheten vid­ tar nödvändiga åtgärder för att alla deras konsumenter ska få ett exemplar av kontrollistan för energianvändare och se till att den finns tillgänglig för allmänheten.

Artikel 4

Tillståndsförfarande

1.När det krävs tillstånd (t.ex. licens, tillåtelse, koncession, samtycke eller godkännande) för uppförande eller drift av natur­ gasanläggningar,skamedlemsstaternaellerdenbehörigamyndig­ het som de utser bevilja tillstånd att anlägga och/eller driva sådana anläggningar, rörledningar och tillhörande utrustning inom sitt territorium i enlighet med punkterna 2–4. Medlemsstaterna eller av dem utsedd behörig myndighet får också, på samma villkor, bevilja tillstånd att leverera naturgas och bevilja tillstånd för grossister.

2.Om medlemsstaterna har ett tillståndssystem ska de fast­ ställa objektiva och icke-diskriminerande kriterier, som ska upp­ fyllas av företag som ansöker om tillstånd för att anlägga och/eller driva naturgasanläggningar eller som ansöker om tillstånd att leverera naturgas. De icke-diskriminerande kriterierna och förfa­ randena för att bevilja tillstånd ska offentliggöras. Medlemssta­ terna ska se till att tillståndsförfaranden för anläggningar, rörledningarochtillhörandeutrustningvidbehovbeaktarprojek­ tets betydelse för den inre naturgasmarknaden.

3.Medlemsstaterna ska säkerställa att skälen för avslag på ansökan om tillstånd är objektiva och icke-diskriminerande och att de meddelas den sökande. Skälen för sådana avslag ska med­ delas kommissionen för kännedom. Medlemsstaterna ska införa ett förfarande som ger den sökande möjlighet att överklaga ett avslag.

4.För att kunna utveckla områden som nyligen har börjat bli försörjda,ochföreffektivdriftiallmänhetochutanattdetpåver­ kar tillämpningen av artikel 38, får medlemsstaterna avslå en ansökanomytterligaretillståndattanläggaochdrivarörlednings­

11.Medlemsstaternaskanärdegenomförtdettadirektivinfor­ system för distribution inom något visst område efter det att

mera kommissionen om vilka åtgärder som vidtagits för att full­ göra förpliktelserna att tillhandahålla allmännyttiga tjänster, inklusive konsument- och miljöskyddsåtgärder, och om

sådana ledningssystem har byggts eller föreslagits bli byggda inom detta område och om befintlig eller föreslagen kapacitet inte är mättad.

115

Prop. 2011/12:77

Bilaga 2

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/105

 

 

 

 

Artikel 5

Övervakning av försörjningstryggheten

Medlemsstaterna ska se till att frågor som rör försörjningstrygg­ het övervakas. Vid behov får medlemsstaterna överlåta denna uppgifttilldetillsynsmyndighetersomavsesiartikel39.1.Denna

övervakning ska i synnerhet omfatta balansen mellan tillgång och efterfråganpådeninhemskamarknaden,förväntadframtidaefter­ frågan, ytterligare kapacitet som planeras eller håller på att anläg­ gas, samt nätens kvalitet och underhållsnivå samt åtgärder för att täcka efterfrågetoppar och hantera brister i leverans från en eller flera gashandlares sida. De behöriga myndigheterna ska senast den 31 juli varje år offentliggöra en rapport i vilken resultaten av

övervakningen av dessa frågor och de åtgärder som vidtagits eller planerats ska anges; rapporten ska därefter genast överlämnas till kommissionen.

Artikel 6

Regional solidaritet

medlemsstaterna främja och underlätta regionalt samarbete mel­ lan de systemansvariga för överföringssystemen, bland annat i gränsöverskridande frågor, för att skapa en konkurrensutsatt inre marknad för naturgas, verka för att lagar, föreskrifter och tekniska ramar är konsekventa och underlätta integrationen av de isolerade system som bildar så kallade gasöar, som fortfarande existerar i gemenskapen. Det geografiska område som omfattas av detta regionala samarbete ska omfatta samarbete inom geografiska områden i enlighet med artikel 12.3 i förordning (EG) nr 715/2009. Detta samarbete får omfatta andra geografiska områden.

2. Byrån ska samarbeta med de nationella tillsynsmyndighe­ terna och de systemansvariga för överföringssystem för att säker­ ställa att de olika regionernas regelverk är förenliga med målet att skapa en konkurrensutsatt inre marknad för naturgas. Om byrån anser att det krävs bindande regler för ett sådant samarbete ska den utfärda lämpliga rekommendationer.

1.För att säkerställa försörjningstryggheten på den inre mark­ naden för naturgas ska medlemsstaterna samarbeta i syfte att främja regional och bilateral solidaritet.

2.Detta samarbete ska omfatta situationer som leder till eller som på kort sikt troligen kommer att leda till allvarliga avbrott i leveranserna som påverkar en medlemsstat. Den ska innefatta

a)samordning av de nationella åtgärder för krissituationer som nämnsiartikel8irådetsdirektiv2004/67/EGavden26april 2004 om åtgärder för att säkerställa en tryggad naturgasförsörjning (1),

b)identifiering och, vid behov, utveckling eller uppgradering av sammanlänkningar av el- och naturgasnät,

c)villkor och praktiska metoder för ömsesidigt stöd.

3.Kommissionen och de övriga medlemsstaterna ska hållas informerade om sådant samarbete.

4.Kommissionen får anta riktlinjer för regionalt samarbete i en solidarisk anda. Dessa åtgärder, som avser att ändra icke väsentliga delar av detta direktiv genom att komplettera det, ska antas i enlighet med det föreskrivande förfarande med kontroll som avses i artikel 51.3.

Artikel 7

Främjande av regionalt samarbete

1. Medlemsstaterna liksom tillsynsmyndigheterna ska samar­ beta med varandra i syfte att integrera sina inhemska marknader på en eller flera regionala nivåer, som ett första steg mot skapan­ det av en helt liberaliserad inre marknad. I synnerhet ska tillsyns­ myndigheterna, om medlemsstaterna föreskrivit detta, eller

3.Medlemsstaterna ska vid genomförandet av detta direktiv se till att de systemansvariga för överföringssystemen har ett eller flera integrerade system på regional nivå som omfattar två eller flera medlemsstater för kapacitetstilldelning och för kontroll av säkerheten för nätet.

4.Om vertikalt integrerade systemansvariga för överförings­ systemendeltariettsamriskföretagsombildatsisyfteattgenom­ föra samarbetet, ska samriskföretaget upprätta och genomföra en övervakningsplan med åtgärder som ska vidtas för att förhindra diskriminerandeochkonkurrensbegränsandebeteende.Iövervak­ ningsplanen ska det anges vilka specifika skyldigheter de anställda har för att uppfylla målet att utesluta diskriminering och beteende som motverkar konkurrens. Planen ska underställas byråns god­ kännande. De övervakningsansvariga hos de vertikalt integrerade systemansvariga för överföringssystemen ska oberoende av andra kontrollera att planen följs.

Artikel 8

Tekniska regler

Tillsynsmyndigheterna, om medlemsstaterna föreskrivit detta, eller medlemsstaterna ska se till att tekniska säkerhetskriterier definieras och att det utarbetas och offentliggörs tekniska regler, i vilka delägstatekniska konstruktions- ochdriftkraven föranslut­ ning till systemet av LNG-anläggningar, lagringsanläggningar, andra överförings- eller distributionssystem och direktledningar fastställs. Dessa tekniska regler ska säkerställa att systemen är driftskompatibla, och de ska vara objektiva och icke- diskriminerande. Byrån får vid behov utfärda lämpliga rekom­ mendationer för att dessa regler ska bli förenliga med varandra.

Dessa regler ska anmälas till kommissionen i enlighet med arti­ kel 8 i Europaparlamentets och rådets direktiv 98/34/EG av den 22juni1998om ett informationsförfarande beträffande tekniska standarder och föreskrifter och beträffande föreskrifter för infor­ mationssamhällets tjänster (2).

(1) EUT L 127, 29.4.2004, s. 92.

(2) EGT L 204, 21.7.1998, s. 37.

116

Prop. 2011/12:77

Bilaga 2

L 211/106

SV

Europeiska unionens officiella tidning

14.8.2009

 

 

 

 

KAPITEL III

ÖVERFÖRING, LAGRING OCH LNG

Artikel 9

Åtskillnad av överföringssystem och systemansvariga för överföringssystem (TSO)

1. Medlemsstaterna ska se till att följande gäller från och med den 3 mars 2012.

a)Varje företag som äger ett överföringssystem ska agera som systemansvarig för överföringssystemet.

b)Samma person(er) får inte

i)direkt eller indirekt utöva kontroll över ett företag som bedriver produktions- eller leveransverksamhet och direkt eller indirekt utöva kontroll över eller någon rät­ tighet gentemot en systemansvarig för överföringssys­ tem eller ett överföringssystem, eller

ii)direkt eller indirekt utöva kontroll över en systemansva­ rig för överföringssystem eller över ett överföringssys­ tem och direkt eller indirekt utöva kontroll över eller någon rättighet gentemot ett företag som bedriver produktions- eller leveransverksamhet.

c)Samma person(er) får inte, för en systemansvarig för överfö­ ringssystem eller för ett överföringssystem, utse ledamöter till styrelsen, tillsynsorganet eller organ som juridiskt företräder företaget, och direkt eller indirekt utöva kontroll över eller någon rättighet gentemot ett företag som bedriver produktions- eller leveransverksamhet.

d)Samma person får inte vara ledamot i styrelsen, tillsynsorga­ net eller organ som juridiskt företräder företaget för både ett företag som bedriver produktions- eller leveransverksamhet och en systemansvarig för överföringssystem eller ett överföringssystem.

2. De rättigheter som avses i punkt 1 b och c ska i synnerhet omfatta

a)rätten att rösta,

b)befogenheten att utse ledamöter till styrelsen, tillsynsorganet eller organ som juridiskt företräder företaget, eller

c)rätten att inneha ägarmajoriteten.

3.I punkt 1bska begreppet ”företag som bedriver produktions- eller leveransverksamhet” omfatta det som avses med detta begrepp i Europaparlamentets och rådets direktiv

2009/72/EGavden13juli2009om gemensamma regler för den inre marknaden för el (1), och termerna ”systemansvarig för över- föringssystem” och ”överföringssystem” omfatta ”systemansvarig för överföringssystem” och ”överföringssystem” i den mening som avses i det direktivet.

4.Medlemsstaterna får bevilja undantag från punkt 1 b och c till och med den 3 mars 2013, under förutsättning att den syste­ mansvarige för överföringssystemet inte ingår i ett vertikalt inte­ grerat företag.

5.Den skyldighet som avses i punkt 1 a ska anses vara full­ gjord då två eller flera företag som äger överföringssystem har upprättat ett samriskföretag som för de berörda överföringssys­ temen fungerar som systemansvarig för överföringssystem i två eller flera medlemsstater. Inget annat företag får ingå i samriskfö­ retagetsåvidadetintehargodkäntssomoberoendesystemansva­ rig i enlighet med artikel 14 eller som en oberoende systemansvarig för överföring i enlighet med kapitel IV.

6.Vid tillämpningen av denna artikel ska, om den person som avses i punkt 1 b, c och d är medlemsstaten eller ett annat offent­ ligt organ, två separata offentliga organ som utövar kontroll över, å ena sidan, en systemansvarig för överföringssystemet eller över ett överföringssystem och, å andra sidan, över ett företag som bedriver antigen produktions- eller leveransverksamhet, inte anses vara samma person eller samma personer.

7.Medlemsstaterna ska se till att varken sådana kommersiellt känsliga uppgifter som avses i artikel 16, och som innehas av en systemansvarig för överföringssystemet som har ingått i ett ver­ tikalt integrerat företag, eller personal hos en sådan systemansva­ rig för överföringssystemet överförs till företag som bedriver produktions- eller leveransverksamhet.

8.Om överföringssystemet den 3 september 2009 tillhör ett vertikalt integrerat företag, får en medlemsstat besluta att inte til­ lämpa punkt 1.

I sådant fall ska den berörda medlemsstaten antingen

a)utse en oberoende systemansvarig i enlighet med artikel 14, eller

b)följa bestämmelserna i kapitel IV.

9. Om överföringssystemet den 3 september 2009 tillhör ett vertikaltintegreratföretag,ochdetfinnsarrangemangsomsäker­ ställer att den systemansvarige för överföringssystemet faktiskt är mer oberoende än vad som föreskrivs i bestämmelserna i kapi­ tel IV, får medlemsstaterna besluta att inte tillämpa punkt 1.

(1) Se sidan 55 i detta nummer av EUT.

117

Prop. 2011/12:77

Bilaga 2

14.8.2009

SV

Europeiska unionens officiella tidning

L 211/107

 

 

 

 

10.Innan ett företag godkänns och utses till systemansvarig för överföringssystem enligt punkt 9 i denna artikel, ska det cer­ tifierasienlighetmeddeförfarandensomföreskrivsiartikel10.4, 10.5 och 10. 6 i detta direktiv och i artikel 3 i förordning (EG) nr 715/2009, enligt vilken kommissionen ska kontrollera att befintliga arrangemang klart säkerställer ett mer effektivt obero­ endefördensystemansvarigeföröverföringssystemetänbestäm­ melserna i kapitel IV.

11.Vertikalt integrerade företag som äger ett överföringssys­ tem får inte i något fall hindras från att vidta åtgärder för att upp­ fylla villkoren i punkt 1.

12.Företag som bedriver någon av funktionerna produktions- eller leveransverksamhet får inte under några omständigheter kunna direkt eller indirekt ta kontroll över eller utöva någon rät­ tighet gentemot systemansvariga för överföringssystem med

åtskild ägare i medlemsstater som tillämpar punkt 1.

Artikel 10

Utseende och certifiering av systemansvariga för överföringssystem (TSO)

1.Innan ett företag godkänns och utses till systemansvarig för

överföringssystem ska det certifieras enligt förfarandena i punk­ terna4,5och6idenhärartikelnochiartikel3iförordning(EG) nr 715/2009.

2.Ett företag som äger ett överföringssystem och som av den nationella tillsynsmyndigheten, till följd av nedanstående certifie­ ringsförfarande, intygas uppfylla kraven i artikel 9, ska av med­ lemsstaterna godkännas och utses till systemansvarig för

överföringssystemet. Utnämningen av systemansvariga för över­ föringssystemet ska anmälas till kommissionen och offentliggö­ ras i Europeiska unionens officiella tidning.

3.Systemansvariga för överföringssystemet ska till tillsyns­ myndigheten anmäla planerade transaktioner som kan komma att kräva en omprövning av huruvida de uppfyller kraven i artikel 9.

4.Tillsynsmyndigheterna ska kontrollera att de systemansva­ riga för överföringssystemet fortlöpande uppfyller kraven i arti­ kel 9. För att säkerställa att kraven uppfylls ska de i följande fall inleda ett certifieringsförfarande:

a)Efter anmälan från den systemansvarige för överföringssys­ temet i enlighet med punkt 3.

b)På eget initiativ då de får vetskap om att en planerad föränd­ ring när det gäller rättigheter gentemot eller inflytande över ägare av eller systemansvariga för överföringssystemet kan ledatillöverträdelseavartikel 9,ellerdådeharanledning att misstänka att en sådan överträdelse kan ha skett.

c)Efter en motiverad begäran från kommissionen.

5.Tillsynsmyndigheterna ska fatta beslut om certifiering av en systemansvarig för överföringssystemet inom fyra månader från den dag då denne inkom med anmälan eller kommissionen över­ lämnade sin begäran. När denna period har löpt ut ska certifie­ ringen anses vara beviljad. Tillsynsmyndighetens uttryckliga eller underförstådda beslut ska börja gälla först efter det att det förfa­ rande som avses i punkt 6 har fullföljts.

6.Tillsynsmyndigheten ska utan dröjsmål anmäla det uttryck­ liga eller underförstådda beslutet om certifiering av en systeman­ svarig för överföringssystemet till kommissionen, och förse kommissionen med alla relevanta uppgifter avseende detta beslut.

Kommissionen ska agera i enlighet med förfarandet i artikel 3 i förordning (EG) nr 715/2009.

7.Tillsynsmyndigheterna och kommissionen har rätt att från systemansvariga för överföringssystem och företag som bedriver produktions- eller leveransverksamhet begära sådan information som är relevant för fullgörandet av deras skyldigheter enligt denna artikel.

8.Tillsynsmyndighetenochkommissionenskabehandlakom­ mersiellt känsliga uppgifter konfidentiellt.

Artikel 11

Certifiering i förhållande till tredjeländer

1. Om certifiering begärs av ägaren till eller den systemansva­ rige för ett överföringssystem som kontrolleras av en eller flera personer från tredjeländer, ska tillsynsmyndigheten underrätta kommissionen.

Tillsynsmyndigheten ska även utan dröjsmål underrätta kommis­ sionen om eventuella omständigheter som skulle leda till att en eller flera personer från tredjeländer får kontroll över ett överfö­ ringssystem eller en systemansvarig för överföringssystem.

2.Den systemansvariga för överföringssystemet ska underrätta tillsynsmyndigheten om eventuella omständigheter som skulle leda till att en eller flera personer från tredjeländer får kontroll

över överföringssystemet eller den systemansvarige för överföringssystemet.

3.Tillsynsmyndi